BLASTX nr result
ID: Ziziphus21_contig00042207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042207 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY19700.1| hypothetical protein UCDDS831_g05359 [Diplodia se... 82 1e-13 gb|EKG15192.1| hypothetical protein MPH_07639 [Macrophomina phas... 82 1e-13 ref|XP_007579914.1| hypothetical protein UCRNP2_588 [Neofusicocc... 81 3e-13 ref|XP_001585368.1| predicted protein [Sclerotinia sclerotiorum ... 72 2e-10 ref|XP_001551111.1| predicted protein [Botrytis cinerea B05.10] ... 68 2e-09 gb|ESZ89817.1| hypothetical protein SBOR_9795 [Sclerotinia borea... 68 3e-09 gb|KFY26271.1| hypothetical protein V491_01382 [Pseudogymnoascus... 66 9e-09 gb|KFX98869.1| hypothetical protein V490_02070 [Pseudogymnoascus... 66 9e-09 ref|XP_012741996.1| hypothetical protein GMDG_03579 [Pseudogymno... 66 9e-09 gb|KFY63002.1| hypothetical protein V496_04274 [Pseudogymnoascus... 65 2e-08 gb|KFY17738.1| hypothetical protein V492_00406 [Pseudogymnoascus... 64 3e-08 gb|KIN07278.1| hypothetical protein OIDMADRAFT_185729 [Oidiodend... 62 2e-07 ref|XP_007290979.1| hypothetical protein MBM_03090 [Marssonina b... 62 2e-07 emb|CCU82141.1| hypothetical protein BGHDH14_bgh03543 [Blumeria ... 59 1e-06 ref|XP_001912047.1| hypothetical protein [Podospora anserina S m... 59 1e-06 gb|EPQ62077.1| hypothetical protein BGT96224_3488 [Blumeria gram... 59 2e-06 >gb|KKY19700.1| hypothetical protein UCDDS831_g05359 [Diplodia seriata] Length = 66 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW KT+RSRAIL+PYY +LWGGFGASMYMM RQVLGKKTW+ Sbjct: 25 RQWNKTARSRAILMPYYIMLWGGFGASMYMMCRQVLGKKTWY 66 >gb|EKG15192.1| hypothetical protein MPH_07639 [Macrophomina phaseolina MS6] Length = 66 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQWQKTSRSRAIL+PY +LWGGFGASMYMM RQVLGKKTW+ Sbjct: 25 RQWQKTSRSRAILLPYNIMLWGGFGASMYMMCRQVLGKKTWY 66 >ref|XP_007579914.1| hypothetical protein UCRNP2_588 [Neofusicoccum parvum UCRNP2] gi|485929140|gb|EOD52612.1| hypothetical protein UCRNP2_588 [Neofusicoccum parvum UCRNP2] Length = 66 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQWQKTSRS+AIL+PY +LWGGFGASMYMM RQVLGKKTW+ Sbjct: 25 RQWQKTSRSKAILLPYNIMLWGGFGASMYMMCRQVLGKKTWY 66 >ref|XP_001585368.1| predicted protein [Sclerotinia sclerotiorum 1980] gi|154699010|gb|EDN98748.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 71 Score = 72.0 bits (175), Expect = 2e-10 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +TSRSR +L PYY LWGGF SMYMMTR V G KTWF Sbjct: 27 RQWNQTSRSRVLLYPYYVALWGGFAGSMYMMTRMVFGHKTWF 68 >ref|XP_001551111.1| predicted protein [Botrytis cinerea B05.10] gi|347442104|emb|CCD35025.1| hypothetical protein BofuT4_P083470.1 [Botrytis cinerea T4] gi|472240341|gb|EMR85113.1| hypothetical protein BcDW1_6264 [Botrytis cinerea BcDW1] Length = 71 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T RS+ +L PYY LWGGF SMYMM+R VLG KTWF Sbjct: 27 RQWNQTPRSKIMLYPYYVALWGGFAGSMYMMSRMVLGHKTWF 68 >gb|ESZ89817.1| hypothetical protein SBOR_9795 [Sclerotinia borealis F-4157] Length = 71 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T +SR +L PYY LWGGF SMYMM+R VLG KTWF Sbjct: 27 RQWNQTPKSRIMLYPYYLCLWGGFAGSMYMMSRMVLGHKTWF 68 >gb|KFY26271.1| hypothetical protein V491_01382 [Pseudogymnoascus pannorum VKM F-3775] gi|682328989|gb|KFY28930.1| hypothetical protein V493_02682 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 71 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T+RS+ +L PYYT+L+GG SMYMM+R VLG KTWF Sbjct: 27 RQWNQTARSKILLYPYYTILFGGLAGSMYMMSRMVLGHKTWF 68 >gb|KFX98869.1| hypothetical protein V490_02070 [Pseudogymnoascus pannorum VKM F-3557] gi|682281954|gb|KFY02902.1| hypothetical protein O988_01828 [Pseudogymnoascus pannorum VKM F-3808] gi|682381336|gb|KFY64353.1| hypothetical protein V497_01768 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] gi|682405203|gb|KFY80724.1| hypothetical protein V499_00432 [Pseudogymnoascus pannorum VKM F-103] gi|682416323|gb|KFY87184.1| hypothetical protein V500_07112 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682443988|gb|KFZ05495.1| hypothetical protein V501_08282 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] gi|682449623|gb|KFZ09444.1| hypothetical protein V502_08723 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 71 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T+RS+ +L PYYT+L+GG SMYMM+R VLG KTWF Sbjct: 27 RQWNQTARSKILLYPYYTILFGGLAGSMYMMSRMVLGHKTWF 68 >ref|XP_012741996.1| hypothetical protein GMDG_03579 [Pseudogymnoascus destructans 20631-21] gi|440638993|gb|ELR08912.1| hypothetical protein GMDG_03579 [Pseudogymnoascus destructans 20631-21] Length = 101 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T+RS+ +L PYYT+L+GG SMYMM+R VLG KTWF Sbjct: 57 RQWNQTARSKILLYPYYTILFGGLAGSMYMMSRMVLGHKTWF 98 >gb|KFY63002.1| hypothetical protein V496_04274 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682435616|gb|KFZ00407.1| hypothetical protein V498_00126 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 71 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T+RS+ +L PYYT+L+GG SMYMM+R V G KTWF Sbjct: 27 RQWNQTARSKVLLYPYYTILFGGLAGSMYMMSRMVFGHKTWF 68 >gb|KFY17738.1| hypothetical protein V492_00406 [Pseudogymnoascus pannorum VKM F-4246] gi|682348865|gb|KFY41142.1| hypothetical protein V494_03150 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 71 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T+RS+ +L PYYT+L+GG AS YMM+R V G KTWF Sbjct: 27 RQWNQTARSKVLLYPYYTILFGGLAASTYMMSRMVFGHKTWF 68 >gb|KIN07278.1| hypothetical protein OIDMADRAFT_185729 [Oidiodendron maius Zn] Length = 71 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T RSR +L PYY +L+GGF SMYMM+R VLG + WF Sbjct: 25 RQWLQTPRSRPMLYPYYVVLFGGFAGSMYMMSRMVLGHRDWF 66 >ref|XP_007290979.1| hypothetical protein MBM_03090 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865807|gb|EKD18848.1| hypothetical protein MBM_03090 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 71 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 RQW +T RS+ IL PYY L+GG SMYMM R VLG KTWF Sbjct: 27 RQWNQTPRSKFILYPYYVALFGGLAGSMYMMCRMVLGHKTWF 68 >emb|CCU82141.1| hypothetical protein BGHDH14_bgh03543 [Blumeria graminis f. sp. hordei DH14] Length = 71 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF*T 124 R W+ + RS+ +L PYYT++WG ASMY M R VLG KTWF T Sbjct: 27 RLWETSHRSKFLLYPYYTIMWGTLAASMYCMCRLVLGHKTWFGT 70 >ref|XP_001912047.1| hypothetical protein [Podospora anserina S mat+] gi|170947071|emb|CAP73876.1| unnamed protein product [Podospora anserina S mat+] gi|681096146|emb|CDP26275.1| Putative protein of unknown function [Podospora anserina S mat+] Length = 70 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF 130 R W+ + RS +L PYY L+WG FGASMY M RQV G KTWF Sbjct: 26 RIWRISPRSGLMLTPYYALMWGTFGASMYAMGRQVCGYKTWF 67 >gb|EPQ62077.1| hypothetical protein BGT96224_3488 [Blumeria graminis f. sp. tritici 96224] Length = 71 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = -1 Query: 255 RQWQKTSRSRAILIPYYTLLWGGFGASMYMMTRQVLGKKTWF*T 124 R W+ + RS+ +L PYYT++WG ASMY M R VLG KTWF T Sbjct: 27 RLWETSHRSKFMLYPYYTIMWGTLAASMYCMCRLVLGHKTWFGT 70