BLASTX nr result
ID: Ziziphus21_contig00042104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042104 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105722.1| hypothetical protein L484_014210 [Morus nota... 64 6e-08 ref|XP_011076474.1| PREDICTED: uncharacterized protein LOC105160... 57 7e-06 >ref|XP_010105722.1| hypothetical protein L484_014210 [Morus notabilis] gi|587918436|gb|EXC05942.1| hypothetical protein L484_014210 [Morus notabilis] Length = 213 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -3 Query: 154 RADSPKFRINSITIQDLIINNSDSESPSVNMRLGAEIAVKNTNFWEFKFED 2 R P+ RI S+ I+DL I+NSD+ SPS++M+ +EI VKNTNF EFKF++ Sbjct: 63 RIKGPELRIRSVAIEDLTISNSDTNSPSLSMKFDSEIGVKNTNFGEFKFDE 113 >ref|XP_011076474.1| PREDICTED: uncharacterized protein LOC105160691 [Sesamum indicum] Length = 159 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -3 Query: 154 RADSPKFRINSITIQDLIINNSDSESPSVNMRLGAEIAVKNTNFWEFKFED 2 R +PK R S+T++ L +N++ S PS++MRL ++ VKNTNF EFKF + Sbjct: 11 RVRTPKVRFGSLTVEALTLNSTTSTQPSLSMRLNTQVTVKNTNFGEFKFSE 61