BLASTX nr result
ID: Ziziphus21_contig00042093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042093 (518 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRT81157.1| hypothetical protein AMK59_5386 [Oryctes borbonicus] 60 8e-07 >gb|KRT81157.1| hypothetical protein AMK59_5386 [Oryctes borbonicus] Length = 113 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/49 (46%), Positives = 31/49 (63%) Frame = -2 Query: 226 NPCVKGCSITYDYRPFCGSDGRTYPTKSYLGCFQRCNIQITQAYEGRCN 80 +PC + C +T +Y P CGSDGRTY + C RC QIT+ + GRC+ Sbjct: 62 SPCEEACLVTPEYNPICGSDGRTYTNEGRFSCALRCGKQITRVFYGRCS 110