BLASTX nr result
ID: Ziziphus21_contig00042006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042006 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583549.1| putative ubiquitin-40s ribosomal protein s31... 89 1e-15 gb|KIW05468.1| ubiquitin-40S ribosomal protein S27a [Verruconis ... 87 6e-15 gb|KJX99401.1| hypothetical protein TI39_contig359g00017 [Zymose... 86 8e-15 gb|KIW11051.1| ubiquitin-40S ribosomal protein S27a [Exophiala s... 86 8e-15 ref|XP_003851546.1| ubiquitin-40S ribosomal protein S31 [Zymosep... 86 8e-15 ref|XP_008029241.1| hypothetical protein SETTUDRAFT_94331 [Setos... 86 1e-14 ref|XP_007685506.1| hypothetical protein COCMIDRAFT_88724 [Bipol... 86 1e-14 ref|XP_003839401.1| similar to ubiquitin / ribosomal protein S27... 86 1e-14 ref|XP_003296988.1| ubiquitin-40S ribosomal protein S31 fusion p... 86 1e-14 ref|XP_001941819.1| ubiquitin-40S ribosomal protein S31 fusion p... 86 1e-14 gb|KIH93873.1| small subunit ribosomal protein S27Ae [Sporothrix... 85 2e-14 gb|ERS98830.1| ubiquitin-40S ribosomal protein S27a [Sporothrix ... 85 2e-14 gb|KIV82057.1| ubiquitin-40S ribosomal protein S27a [Exophiala s... 84 3e-14 ref|XP_007841585.1| Ubiquitin-40S ribosomal protein S27a [Pestal... 84 3e-14 ref|XP_007677031.1| hypothetical protein BAUCODRAFT_156971 [Baud... 84 3e-14 ref|XP_003713173.1| ubiquitin-40S ribosomal protein S27a [Magnap... 84 3e-14 gb|KPI44385.1| Ubiquitin-40S ribosomal protein S27a [Phialophora... 84 4e-14 gb|KIY03162.1| ubiquitin-40S ribosomal protein S27a [Fonsecaea m... 84 4e-14 ref|XP_013267883.1| ubiquitin-40S ribosomal protein S27a [Rhinoc... 84 4e-14 gb|KIW69010.1| ubiquitin-40S ribosomal protein S27a [Capronia se... 84 4e-14 >ref|XP_007583549.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Neofusicoccum parvum UCRNP2] gi|485924071|gb|EOD48984.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Neofusicoccum parvum UCRNP2] gi|821071529|gb|KKY26531.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Diplodia seriata] Length = 154 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 133 >gb|KIW05468.1| ubiquitin-40S ribosomal protein S27a [Verruconis gallopava] Length = 154 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQE CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQETCGAGVFMA 133 >gb|KJX99401.1| hypothetical protein TI39_contig359g00017 [Zymoseptoria brevis] Length = 197 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP EQCGAG+FMA Sbjct: 136 HKRKKTKLAVLKYYKVDGDGKIERLRRECPAEQCGAGIFMA 176 >gb|KIW11051.1| ubiquitin-40S ribosomal protein S27a [Exophiala spinifera] Length = 154 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQ++CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQKECGAGVFMA 133 >ref|XP_003851546.1| ubiquitin-40S ribosomal protein S31 [Zymoseptoria tritici IPO323] gi|339471426|gb|EGP86522.1| hypothetical protein MYCGRDRAFT_104912 [Zymoseptoria tritici IPO323] Length = 155 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP EQCGAG+FMA Sbjct: 94 HKRKKTKLAVLKYYKVDGDGKIERLRRECPAEQCGAGIFMA 134 >ref|XP_008029241.1| hypothetical protein SETTUDRAFT_94331 [Setosphaeria turcica Et28A] gi|482806488|gb|EOA83561.1| hypothetical protein SETTUDRAFT_94331 [Setosphaeria turcica Et28A] Length = 154 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQ +CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQPECGAGVFMA 133 >ref|XP_007685506.1| hypothetical protein COCMIDRAFT_88724 [Bipolaris oryzae ATCC 44560] gi|628071447|ref|XP_007700377.1| hypothetical protein COCSADRAFT_37257 [Bipolaris sorokiniana ND90Pr] gi|628190168|ref|XP_007708418.1| hypothetical protein COCCADRAFT_1856 [Bipolaris zeicola 26-R-13] gi|928509895|ref|XP_014073751.1| hypothetical protein COCC4DRAFT_207287 [Bipolaris maydis ATCC 48331] gi|953431615|ref|XP_014557879.1| hypothetical protein COCVIDRAFT_36742 [Bipolaris victoriae FI3] gi|451850180|gb|EMD63482.1| hypothetical protein COCSADRAFT_37257 [Bipolaris sorokiniana ND90Pr] gi|451993312|gb|EMD85786.1| hypothetical protein COCHEDRAFT_1228811 [Bipolaris maydis C5] gi|477582722|gb|ENH99827.1| hypothetical protein COCC4DRAFT_207287 [Bipolaris maydis ATCC 48331] gi|576923154|gb|EUC37275.1| hypothetical protein COCCADRAFT_1856 [Bipolaris zeicola 26-R-13] gi|576934418|gb|EUC47932.1| hypothetical protein COCMIDRAFT_88724 [Bipolaris oryzae ATCC 44560] gi|578490879|gb|EUN28291.1| hypothetical protein COCVIDRAFT_36742 [Bipolaris victoriae FI3] Length = 154 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQ +CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQPECGAGVFMA 133 >ref|XP_003839401.1| similar to ubiquitin / ribosomal protein S27a [Leptosphaeria maculans JN3] gi|312215970|emb|CBX95922.1| similar to ubiquitin / ribosomal protein S27a [Leptosphaeria maculans JN3] Length = 154 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQ +CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQPECGAGVFMA 133 >ref|XP_003296988.1| ubiquitin-40S ribosomal protein S31 fusion protein [Pyrenophora teres f. teres 0-1] gi|311330589|gb|EFQ94925.1| hypothetical protein PTT_07252 [Pyrenophora teres f. teres 0-1] gi|909990627|gb|KNG48109.1| ubiquitin-40s ribosomal protein s27a [Stemphylium lycopersici] Length = 154 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQ +CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQPECGAGVFMA 133 >ref|XP_001941819.1| ubiquitin-40S ribosomal protein S31 fusion protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977912|gb|EDU44538.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 154 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQ +CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQPECGAGVFMA 133 >gb|KIH93873.1| small subunit ribosomal protein S27Ae [Sporothrix brasiliensis 5110] Length = 154 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP E CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPNETCGAGVFMA 133 >gb|ERS98830.1| ubiquitin-40S ribosomal protein S27a [Sporothrix schenckii ATCC 58251] gi|780592809|gb|KJR83568.1| small subunit ribosomal protein S27Ae [Sporothrix schenckii 1099-18] Length = 154 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP E CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPNETCGAGVFMA 133 >gb|KIV82057.1| ubiquitin-40S ribosomal protein S27a [Exophiala sideris] Length = 154 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP ++CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPAQECGAGVFMA 133 >ref|XP_007841585.1| Ubiquitin-40S ribosomal protein S27a [Pestalotiopsis fici W106-1] gi|573053890|gb|ETS73867.1| Ubiquitin-40S ribosomal protein S27a [Pestalotiopsis fici W106-1] Length = 153 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP E CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPAETCGAGVFMA 133 >ref|XP_007677031.1| hypothetical protein BAUCODRAFT_156971 [Baudoinia panamericana UAMH 10762] gi|449299522|gb|EMC95535.1| hypothetical protein BAUCODRAFT_156971 [Baudoinia panamericana UAMH 10762] Length = 154 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP E CGAG+FMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPHETCGAGIFMA 133 >ref|XP_003713173.1| ubiquitin-40S ribosomal protein S27a [Magnaporthe oryzae 70-15] gi|685399374|ref|XP_009218549.1| ubiquitin-40S ribosomal protein S27a [Gaeumannomyces graminis var. tritici R3-111a-1] gi|291195749|gb|ADD84591.1| poly-ubiquitin [Magnaporthe oryzae] gi|351645505|gb|EHA53366.1| ubiquitin-40S ribosomal protein S27a [Magnaporthe oryzae 70-15] gi|402087642|gb|EJT82540.1| ubiquitin-40S ribosomal protein S27a [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440466447|gb|ELQ35714.1| ubiquitin [Magnaporthe oryzae Y34] gi|440488149|gb|ELQ67889.1| ubiquitin [Magnaporthe oryzae P131] gi|835899524|gb|KLU90898.1| ubiquitin-40S ribosomal protein S27a [Magnaporthiopsis poae ATCC 64411] Length = 154 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP E CGAG+FMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPNETCGAGIFMA 133 >gb|KPI44385.1| Ubiquitin-40S ribosomal protein S27a [Phialophora attae] Length = 158 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP ++CGAGVFMA Sbjct: 97 HKRKKTKLAVLKYYKVDGDGKIERLRRECPTKECGAGVFMA 137 >gb|KIY03162.1| ubiquitin-40S ribosomal protein S27a [Fonsecaea multimorphosa CBS 102226] Length = 154 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP ++CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPTKECGAGVFMA 133 >ref|XP_013267883.1| ubiquitin-40S ribosomal protein S27a [Rhinocladiella mackenziei CBS 650.93] gi|759324415|gb|KIX00747.1| ubiquitin-40S ribosomal protein S27a [Rhinocladiella mackenziei CBS 650.93] Length = 154 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP ++CGAGVFMA Sbjct: 93 HKRKKTKLAVLKYYKVDGDGKIERLRRECPTKECGAGVFMA 133 >gb|KIW69010.1| ubiquitin-40S ribosomal protein S27a [Capronia semiimmersa] Length = 158 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 303 HKRKKTKLAVLKYYKVDGDGKIERLRRECPQEQCGAGVFMA 181 HKRKKTKLAVLKYYKVDGDGKIERLRRECP ++CGAGVFMA Sbjct: 97 HKRKKTKLAVLKYYKVDGDGKIERLRRECPTKECGAGVFMA 137