BLASTX nr result
ID: Ziziphus21_contig00041672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041672 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007580161.1| putative alpha-glucosidase protein [Neofusic... 115 1e-23 gb|KKY13736.1| putative alpha-glucosidase [Diplodia seriata] 94 5e-17 gb|KIY04147.1| hypothetical protein Z520_00839 [Fonsecaea multim... 61 3e-07 gb|ETK81064.1| hypothetical protein L915_13408 [Phytophthora par... 61 4e-07 ref|XP_008894618.1| hypothetical protein PPTG_03687 [Phytophthor... 61 4e-07 gb|ETO77191.1| hypothetical protein, variant 1 [Phytophthora par... 60 6e-07 ref|XP_008904199.1| hypothetical protein PPTG_10577 [Phytophthor... 60 6e-07 gb|ETM48140.1| hypothetical protein L914_07279 [Phytophthora par... 60 6e-07 gb|ETI48391.1| hypothetical protein F443_07568 [Phytophthora par... 60 6e-07 >ref|XP_007580161.1| putative alpha-glucosidase protein [Neofusicoccum parvum UCRNP2] gi|485928686|gb|EOD52351.1| putative alpha-glucosidase protein [Neofusicoccum parvum UCRNP2] Length = 811 Score = 115 bits (289), Expect = 1e-23 Identities = 62/94 (65%), Positives = 71/94 (75%), Gaps = 1/94 (1%) Frame = -2 Query: 279 MQHPLVCPXXXXXXXXXXAVFGTNAPTVAAGSVQEYSLGA-FSVLVDQGAPTVEIYTSSG 103 MQ PL CP AVFGT AP VAA +V+EYSLG+ +SVLVDQ P+VEIYT SG Sbjct: 1 MQQPL-CPSASTAALAAAAVFGTGAPVVAADAVKEYSLGSSYSVLVDQAVPSVEIYTHSG 59 Query: 102 DEVWKTPTTAPLIAASTGLTNFSDSSGNFEITTN 1 EVWK+P+T P I+AS GLTNFSD+SGNFEITTN Sbjct: 60 AEVWKSPSTHPFISASIGLTNFSDASGNFEITTN 93 >gb|KKY13736.1| putative alpha-glucosidase [Diplodia seriata] Length = 724 Score = 93.6 bits (231), Expect = 5e-17 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 1/63 (1%) Frame = -2 Query: 186 SVQEYSLGAFSVLVDQGAPTVEIYTSSGDEVWKTPTTA-PLIAASTGLTNFSDSSGNFEI 10 +V+ YSLGAFSV VDQGAP+ EI T SG EVWKTPT P I+ASTGLTNFSDSSGNFEI Sbjct: 8 TVKTYSLGAFSVQVDQGAPSFEITTQSGAEVWKTPTDGHPFISASTGLTNFSDSSGNFEI 67 Query: 9 TTN 1 TT+ Sbjct: 68 TTD 70 >gb|KIY04147.1| hypothetical protein Z520_00839 [Fonsecaea multimorphosa CBS 102226] Length = 790 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/63 (44%), Positives = 39/63 (61%) Frame = -2 Query: 189 GSVQEYSLGAFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGLTNFSDSSGNFEI 10 G +G+FS +D A ++ I T+ G VW +P LI+AS+G+ N +DSSGNFEI Sbjct: 31 GQALSGKIGSFSYAIDPQASSISICTADGSSVWSSPRNHALISASSGVANLTDSSGNFEI 90 Query: 9 TTN 1 TN Sbjct: 91 RTN 93 >gb|ETK81064.1| hypothetical protein L915_13408 [Phytophthora parasitica] gi|570321695|gb|ETO69643.1| hypothetical protein F444_13810 [Phytophthora parasitica P1976] Length = 805 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/73 (39%), Positives = 49/73 (67%) Frame = -2 Query: 222 VFGTNAPTVAAGSVQEYSLGAFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGLT 43 + G++ V+A + +Y LG F+V VD +VEI S+GD+VWK+ + I+AS+GLT Sbjct: 14 IAGSSTSPVSAATT-DYPLGPFTVSVDTDGSSVEIANSAGDQVWKSASDRTFISASSGLT 72 Query: 42 NFSDSSGNFEITT 4 + +SGNF++++ Sbjct: 73 TITQASGNFQLSS 85 >ref|XP_008894618.1| hypothetical protein PPTG_03687 [Phytophthora parasitica INRA-310] gi|566018059|gb|ETI40970.1| hypothetical protein F443_13753 [Phytophthora parasitica P1569] gi|567984134|gb|ETL34511.1| hypothetical protein L916_13293 [Phytophthora parasitica] gi|568013587|gb|ETL87764.1| hypothetical protein L917_13116 [Phytophthora parasitica] gi|568043735|gb|ETM41006.1| hypothetical protein L914_13202 [Phytophthora parasitica] gi|568106123|gb|ETN20759.1| hypothetical protein PPTG_03687 [Phytophthora parasitica INRA-310] gi|570945514|gb|ETP10771.1| hypothetical protein F441_13677 [Phytophthora parasitica CJ01A1] gi|570977241|gb|ETP38890.1| hypothetical protein F442_13603 [Phytophthora parasitica P10297] Length = 805 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/73 (39%), Positives = 49/73 (67%) Frame = -2 Query: 222 VFGTNAPTVAAGSVQEYSLGAFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGLT 43 + G++ V+A + +Y LG F+V VD +VEI S+GD+VWK+ + I+AS+GLT Sbjct: 14 IAGSSTSPVSAATT-DYPLGPFTVSVDTDGSSVEIANSAGDQVWKSASDRTFISASSGLT 72 Query: 42 NFSDSSGNFEITT 4 + +SGNF++++ Sbjct: 73 TITQASGNFQLSS 85 >gb|ETO77191.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976] gi|570329244|gb|ETO77192.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976] gi|570329245|gb|ETO77193.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976] Length = 794 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -2 Query: 222 VFGTNAPTVAAGSVQEYSLG-AFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGL 46 + GT V A +V Y LG +F+V VD A +VE+ ++GD+VWK+ + ++ASTGL Sbjct: 10 LIGTTVYQVDA-AVNHYVLGTSFTVAVDVNATSVEVVNTAGDQVWKSASDRAFVSASTGL 68 Query: 45 TNFSDSSGNFEI 10 T + SSGNFE+ Sbjct: 69 TTITQSSGNFEL 80 >ref|XP_008904199.1| hypothetical protein PPTG_10577 [Phytophthora parasitica INRA-310] gi|675190631|ref|XP_008904200.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310] gi|675190633|ref|XP_008904201.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310] gi|568095676|gb|ETN10438.1| hypothetical protein PPTG_10577 [Phytophthora parasitica INRA-310] gi|568095677|gb|ETN10439.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310] gi|568095678|gb|ETN10440.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310] Length = 794 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -2 Query: 222 VFGTNAPTVAAGSVQEYSLG-AFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGL 46 + GT V A +V Y LG +F+V VD A +VE+ ++GD+VWK+ + ++ASTGL Sbjct: 10 LIGTTVYQVDA-AVNHYVLGTSFTVAVDVNATSVEVVNTAGDQVWKSASDRAFVSASTGL 68 Query: 45 TNFSDSSGNFEI 10 T + SSGNFE+ Sbjct: 69 TTITQSSGNFEL 80 >gb|ETM48140.1| hypothetical protein L914_07279 [Phytophthora parasitica] gi|568051227|gb|ETM48141.1| hypothetical protein, variant 1 [Phytophthora parasitica] gi|568051228|gb|ETM48142.1| hypothetical protein, variant 2 [Phytophthora parasitica] Length = 794 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -2 Query: 222 VFGTNAPTVAAGSVQEYSLG-AFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGL 46 + GT V A +V Y LG +F+V VD A +VE+ ++GD+VWK+ + ++ASTGL Sbjct: 10 LIGTTVYQVDA-AVNHYVLGTSFTVAVDVNATSVEVVNTAGDQVWKSASDRAFVSASTGL 68 Query: 45 TNFSDSSGNFEI 10 T + SSGNFE+ Sbjct: 69 TTITQSSGNFEL 80 >gb|ETI48391.1| hypothetical protein F443_07568 [Phytophthora parasitica P1569] gi|566025481|gb|ETI48392.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569] gi|566025482|gb|ETI48393.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569] gi|567962830|gb|ETK88346.1| hypothetical protein L915_07386 [Phytophthora parasitica] gi|567962831|gb|ETK88347.1| hypothetical protein, variant 1 [Phytophthora parasitica] gi|567962832|gb|ETK88348.1| hypothetical protein, variant 2 [Phytophthora parasitica] gi|567991546|gb|ETL41749.1| hypothetical protein L916_07328 [Phytophthora parasitica] gi|567991547|gb|ETL41750.1| hypothetical protein, variant 1 [Phytophthora parasitica] gi|567991548|gb|ETL41751.1| hypothetical protein, variant 2 [Phytophthora parasitica] gi|568020781|gb|ETL94899.1| hypothetical protein L917_07221 [Phytophthora parasitica] gi|568020782|gb|ETL94900.1| hypothetical protein, variant 1 [Phytophthora parasitica] gi|568020783|gb|ETL94901.1| hypothetical protein, variant 2 [Phytophthora parasitica] gi|570952945|gb|ETP18202.1| hypothetical protein F441_07538 [Phytophthora parasitica CJ01A1] gi|570952946|gb|ETP18203.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1] gi|570952947|gb|ETP18204.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1] gi|570987378|gb|ETP46139.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297] gi|570987379|gb|ETP46140.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297] gi|570987380|gb|ETP46141.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297] Length = 794 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -2 Query: 222 VFGTNAPTVAAGSVQEYSLG-AFSVLVDQGAPTVEIYTSSGDEVWKTPTTAPLIAASTGL 46 + GT V A +V Y LG +F+V VD A +VE+ ++GD+VWK+ + ++ASTGL Sbjct: 10 LIGTTVYQVDA-AVNHYVLGTSFTVAVDVNATSVEVVNTAGDQVWKSASDRAFVSASTGL 68 Query: 45 TNFSDSSGNFEI 10 T + SSGNFE+ Sbjct: 69 TTITQSSGNFEL 80