BLASTX nr result
ID: Ziziphus21_contig00041587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041587 (582 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG19123.1| hypothetical protein MPH_03644 [Macrophomina phas... 115 1e-23 ref|XP_007586773.1| putative alpha-methylacyl- racemase protein ... 62 2e-07 >gb|EKG19123.1| hypothetical protein MPH_03644 [Macrophomina phaseolina MS6] Length = 92 Score = 115 bits (289), Expect = 1e-23 Identities = 52/66 (78%), Positives = 60/66 (90%), Gaps = 1/66 (1%) Frame = -3 Query: 553 MGSDKTFFQRLFRVPVAPVGTNIHKKDDFSWLQPSADGPPEIMYPAVN-EQDDQYTHPFD 377 MG DK+F+QRLFRVPVAPVGTNIHKKDD SWLQPSADGPPEI YPAVN +++D YTHP+D Sbjct: 1 MGVDKSFYQRLFRVPVAPVGTNIHKKDDLSWLQPSADGPPEIAYPAVNGDEEDPYTHPYD 60 Query: 376 REKKSR 359 R KK++ Sbjct: 61 RAKKAK 66 >ref|XP_007586773.1| putative alpha-methylacyl- racemase protein [Neofusicoccum parvum UCRNP2] gi|485919407|gb|EOD45745.1| putative alpha-methylacyl- racemase protein [Neofusicoccum parvum UCRNP2] Length = 714 Score = 62.4 bits (150), Expect = 2e-07 Identities = 42/114 (36%), Positives = 62/114 (54%), Gaps = 1/114 (0%) Frame = -3 Query: 523 LFRVPVAPVGTNIHKKDDFSWLQPSADGPPEIMYPAVNEQDDQYTHPFDREKKSRNXXXX 344 +FRVPVAPVGT+I+++DD SWL+ S D P + N+ +D+Y HP+DREKK++ Sbjct: 383 IFRVPVAPVGTSINEQDD-SWLRSSEDPP-----SSSNQDNDEYMHPYDREKKAK----- 431 Query: 343 XXXXXXXXEGKKSQD-NYTPSRRANEKSKKTIRMDQGLLV*AKSSAGIIDRRFG 185 +GK S D + S+R K + R +G + S A +I G Sbjct: 432 -------AKGKGSPDSDPKKSKRQKTKEGQEQRKSRGPSPVSSSEASLISGHSG 478