BLASTX nr result
ID: Ziziphus21_contig00041574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041574 (510 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002432542.1| hypothetical protein Phum_PHUM590900 [Pedicu... 74 4e-11 >ref|XP_002432542.1| hypothetical protein Phum_PHUM590900 [Pediculus humanus corporis] gi|212518002|gb|EEB19804.1| hypothetical protein Phum_PHUM590900 [Pediculus humanus corporis] Length = 127 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = +1 Query: 304 SRTVTALEAFRRNPTDGSLAPTPARASAEPNVRTCRSSRTGQDYYRND 447 SR +ALEAFR NPTDGSLAP R SAEPNVRTC SSRT QDY RND Sbjct: 76 SRPDSALEAFRHNPTDGSLAPPVVRPSAEPNVRTCGSSRTEQDYCRND 123