BLASTX nr result
ID: Ziziphus21_contig00041131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041131 (215 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABM55519.1| putative ribosomal protein L13A [Maconellicoccus ... 74 4e-11 >gb|ABM55519.1| putative ribosomal protein L13A [Maconellicoccus hirsutus] Length = 212 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 109 MPRRGVQPQGLFSKRLYIDGKDHLLGKLASYVAKAL 2 MPRRG+QPQGL+SKRLYIDGKDHLLGKLASYVAKAL Sbjct: 1 MPRRGIQPQGLYSKRLYIDGKDHLLGKLASYVAKAL 36