BLASTX nr result
ID: Ziziphus21_contig00040857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040857 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112940.1| hypothetical protein L484_021461 [Morus nota... 79 1e-12 ref|XP_008233042.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 62 2e-07 ref|XP_013444814.1| PPR containing plant-like protein [Medicago ... 57 7e-06 >ref|XP_010112940.1| hypothetical protein L484_021461 [Morus notabilis] gi|587948872|gb|EXC35099.1| hypothetical protein L484_021461 [Morus notabilis] Length = 683 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Frame = -1 Query: 193 RTNVNATEQVDP-HQPPTCLPLNPLRALMPAYESSYYHDPHWVHSLCSNALKISAKMGFL 17 +T N +++ DP HQ T PL+ LRAL+P +ES+++H+ H HSLCS ALKISAKMGFL Sbjct: 30 KTITNGSKEADPSHQSVTTRPLSRLRALIPVHESAHFHNSHLAHSLCSKALKISAKMGFL 89 Query: 16 CEGKQ 2 EGKQ Sbjct: 90 SEGKQ 94 >ref|XP_008233042.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g46050, mitochondrial [Prunus mume] Length = 665 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -1 Query: 181 NATEQVDP-HQPPTCLPLNPLRALMPAYESSYYHDPHWVHSLCSNALKISAKMGFLCEGK 5 NA DP HQ + + L A +S++++DPH HS CSNALK+SAKMGFL EGK Sbjct: 35 NAPNHADPFHQTSSSFSSSRLGAFTQVPQSTHFNDPHSAHSFCSNALKVSAKMGFLREGK 94 Query: 4 Q 2 Q Sbjct: 95 Q 95 >ref|XP_013444814.1| PPR containing plant-like protein [Medicago truncatula] gi|657373069|gb|KEH18839.1| PPR containing plant-like protein [Medicago truncatula] Length = 655 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -1 Query: 157 HQPPTCLPLNPLRALMPAYESSYYHDPHWVHSLCSNALKISAKMGFLCEGKQ 2 HQP + LRA MP ++++DP+ VH CSNALKISAK G+L EGKQ Sbjct: 30 HQPHPWNSSSRLRASMPIPNQTHFNDPNTVHLFCSNALKISAKKGYLPEGKQ 81