BLASTX nr result
ID: Ziziphus21_contig00040835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040835 (282 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516872.1| hypothetical protein GlmaxMp23 (mitochondrio... 64 3e-08 >ref|YP_007516872.1| hypothetical protein GlmaxMp23 (mitochondrion) [Glycine max] gi|403311593|gb|AFR34341.1| hypothetical protein GlmaxMp23 (mitochondrion) [Glycine max] Length = 103 Score = 64.3 bits (155), Expect = 3e-08 Identities = 42/74 (56%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = -1 Query: 258 MLYQLSYTPPKKVSST*GLVRK---RK*GGPSSSHHIKGARLCMRLVLQSKRRKRKGAR* 88 MLYQLSYTP K + S +V K RK GGPSS HHIKGA+LCMRLVL+SKRR R Sbjct: 1 MLYQLSYTPKKNIDSNI-VVNKDGCRKEGGPSS-HHIKGAQLCMRLVLRSKRRIRARVST 58 Query: 87 HSCKKTA*LTRPLL 46 + K+ + PLL Sbjct: 59 PARKRPYSTSAPLL 72