BLASTX nr result
ID: Ziziphus21_contig00040805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040805 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015498.1| ROP interactive partner 5 isoform 5 [Theobro... 105 1e-20 ref|XP_007015497.1| ROP interactive partner 5 isoform 4 [Theobro... 105 1e-20 ref|XP_007015495.1| ROP interactive partner 5 isoform 2 [Theobro... 105 1e-20 ref|XP_012485254.1| PREDICTED: interactor of constitutive active... 104 3e-20 gb|KHG05291.1| Interactor of constitutive active ROPs 3 -like pr... 103 5e-20 ref|XP_010043695.1| PREDICTED: interactor of constitutive active... 102 9e-20 ref|XP_010043696.1| PREDICTED: interactor of constitutive active... 102 9e-20 gb|KDO73129.1| hypothetical protein CISIN_1g006962mg [Citrus sin... 100 4e-19 gb|KDO73127.1| hypothetical protein CISIN_1g006962mg [Citrus sin... 100 4e-19 ref|XP_002532251.1| ATP binding protein, putative [Ricinus commu... 100 4e-19 ref|XP_006488183.1| PREDICTED: interactor of constitutive active... 100 4e-19 ref|XP_006424657.1| hypothetical protein CICLE_v10027972mg [Citr... 100 4e-19 ref|XP_006424655.1| hypothetical protein CICLE_v10027972mg [Citr... 100 4e-19 ref|XP_012064895.1| PREDICTED: interactor of constitutive active... 97 5e-18 ref|XP_008224813.1| PREDICTED: LOW QUALITY PROTEIN: interactor o... 97 5e-18 ref|XP_012064892.1| PREDICTED: interactor of constitutive active... 97 5e-18 ref|XP_007204977.1| hypothetical protein PRUPE_ppa002832mg [Prun... 97 5e-18 ref|XP_010104142.1| hypothetical protein L484_014428 [Morus nota... 97 6e-18 ref|XP_010651114.1| PREDICTED: interactor of constitutive active... 96 1e-17 ref|XP_010651109.1| PREDICTED: interactor of constitutive active... 96 1e-17 >ref|XP_007015498.1| ROP interactive partner 5 isoform 5 [Theobroma cacao] gi|508785861|gb|EOY33117.1| ROP interactive partner 5 isoform 5 [Theobroma cacao] Length = 621 Score = 105 bits (262), Expect = 1e-20 Identities = 60/111 (54%), Positives = 66/111 (59%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADK+N+R ELRRLKVQSDQWRK AMLSAGNNGK Sbjct: 511 EEADKNNRRAARVAEQLEAAQNANSEIEAELRRLKVQSDQWRKAAEAAAAMLSAGNNGKF 570 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDS+Y+PVTGK+SSPY+E GVLWKKPQK Sbjct: 571 MERTGSLDSHYNPVTGKVSSPYTEDMDDDLLKKKNGNMLKKIGVLWKKPQK 621 >ref|XP_007015497.1| ROP interactive partner 5 isoform 4 [Theobroma cacao] gi|508785860|gb|EOY33116.1| ROP interactive partner 5 isoform 4 [Theobroma cacao] Length = 509 Score = 105 bits (262), Expect = 1e-20 Identities = 60/111 (54%), Positives = 66/111 (59%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADK+N+R ELRRLKVQSDQWRK AMLSAGNNGK Sbjct: 399 EEADKNNRRAARVAEQLEAAQNANSEIEAELRRLKVQSDQWRKAAEAAAAMLSAGNNGKF 458 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDS+Y+PVTGK+SSPY+E GVLWKKPQK Sbjct: 459 MERTGSLDSHYNPVTGKVSSPYTEDMDDDLLKKKNGNMLKKIGVLWKKPQK 509 >ref|XP_007015495.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gi|590585675|ref|XP_007015496.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gi|508785858|gb|EOY33114.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gi|508785859|gb|EOY33115.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] Length = 624 Score = 105 bits (262), Expect = 1e-20 Identities = 60/111 (54%), Positives = 66/111 (59%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADK+N+R ELRRLKVQSDQWRK AMLSAGNNGK Sbjct: 514 EEADKNNRRAARVAEQLEAAQNANSEIEAELRRLKVQSDQWRKAAEAAAAMLSAGNNGKF 573 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDS+Y+PVTGK+SSPY+E GVLWKKPQK Sbjct: 574 MERTGSLDSHYNPVTGKVSSPYTEDMDDDLLKKKNGNMLKKIGVLWKKPQK 624 >ref|XP_012485254.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|823172831|ref|XP_012485255.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|823172834|ref|XP_012485256.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|823172837|ref|XP_012485257.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|763768381|gb|KJB35596.1| hypothetical protein B456_006G121200 [Gossypium raimondii] gi|763768382|gb|KJB35597.1| hypothetical protein B456_006G121200 [Gossypium raimondii] gi|763768383|gb|KJB35598.1| hypothetical protein B456_006G121200 [Gossypium raimondii] Length = 624 Score = 104 bits (259), Expect = 3e-20 Identities = 59/111 (53%), Positives = 64/111 (57%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSN+R ELRRLKVQSDQWRK +MLSAGNNGK Sbjct: 514 EEADKSNRRAARVTEQLEAAQTANSEMEAELRRLKVQSDQWRKAAEAAASMLSAGNNGKF 573 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDSNY+PV GK+S PY+E GVLWKKPQK Sbjct: 574 MERTGSLDSNYNPVKGKVSPPYAEDSDEDLLKKKNGNMLKKIGVLWKKPQK 624 >gb|KHG05291.1| Interactor of constitutive active ROPs 3 -like protein [Gossypium arboreum] Length = 619 Score = 103 bits (257), Expect = 5e-20 Identities = 58/111 (52%), Positives = 64/111 (57%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADK+N+R ELRRLKVQSDQWRK +MLSAGNNGK Sbjct: 509 EEADKNNRRAARVTEQLEAAQTANSEMEAELRRLKVQSDQWRKAAEAAASMLSAGNNGKF 568 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDSNY+PV GK+ SPY+E GVLWKKPQK Sbjct: 569 MERTGSLDSNYNPVKGKVGSPYAEDSDEELLKKKNGNMLKKIGVLWKKPQK 619 >ref|XP_010043695.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Eucalyptus grandis] gi|629121192|gb|KCW85682.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] Length = 625 Score = 102 bits (255), Expect = 9e-20 Identities = 58/111 (52%), Positives = 66/111 (59%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEA+KSN+R ELRRLKVQSDQWRK AMLS+GNNGK Sbjct: 515 EEAEKSNRRAARVTEQLEAAQATSTEMEGELRRLKVQSDQWRKAAEAAAAMLSSGNNGKF 574 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 M+RTGSLDS+YDPVTG++SSPY+E GVLWKKPQK Sbjct: 575 MDRTGSLDSSYDPVTGRMSSPYAEDMDDDMLKKKNGNMLKKIGVLWKKPQK 625 >ref|XP_010043696.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Eucalyptus grandis] gi|702272415|ref|XP_010043697.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Eucalyptus grandis] gi|629121190|gb|KCW85680.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] gi|629121191|gb|KCW85681.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] Length = 622 Score = 102 bits (255), Expect = 9e-20 Identities = 58/111 (52%), Positives = 66/111 (59%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEA+KSN+R ELRRLKVQSDQWRK AMLS+GNNGK Sbjct: 512 EEAEKSNRRAARVTEQLEAAQATSTEMEGELRRLKVQSDQWRKAAEAAAAMLSSGNNGKF 571 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 M+RTGSLDS+YDPVTG++SSPY+E GVLWKKPQK Sbjct: 572 MDRTGSLDSSYDPVTGRMSSPYAEDMDDDMLKKKNGNMLKKIGVLWKKPQK 622 >gb|KDO73129.1| hypothetical protein CISIN_1g006962mg [Citrus sinensis] Length = 438 Score = 100 bits (249), Expect = 4e-19 Identities = 56/111 (50%), Positives = 63/111 (56%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSN+R ELRRLKVQSDQWRK +MLS GNNGK Sbjct: 328 EEADKSNRRAARMAEQLEAAQSANCEAEAELRRLKVQSDQWRKAAEAAASMLSTGNNGKC 387 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MER+GS+DSNY+P+TGKI PYS+ GVLWKKPQK Sbjct: 388 MERSGSIDSNYNPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKPQK 438 >gb|KDO73127.1| hypothetical protein CISIN_1g006962mg [Citrus sinensis] gi|641854320|gb|KDO73128.1| hypothetical protein CISIN_1g006962mg [Citrus sinensis] Length = 623 Score = 100 bits (249), Expect = 4e-19 Identities = 56/111 (50%), Positives = 63/111 (56%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSN+R ELRRLKVQSDQWRK +MLS GNNGK Sbjct: 513 EEADKSNRRAARMAEQLEAAQSANCEAEAELRRLKVQSDQWRKAAEAAASMLSTGNNGKC 572 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MER+GS+DSNY+P+TGKI PYS+ GVLWKKPQK Sbjct: 573 MERSGSIDSNYNPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKPQK 623 >ref|XP_002532251.1| ATP binding protein, putative [Ricinus communis] gi|223528039|gb|EEF30117.1| ATP binding protein, putative [Ricinus communis] Length = 618 Score = 100 bits (249), Expect = 4e-19 Identities = 57/111 (51%), Positives = 64/111 (57%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEAD+SNK+ ELRRLKVQSDQWRK AMLSAGNNG+ Sbjct: 508 EEADRSNKKVARVTEQLEASQAANSEMEAELRRLKVQSDQWRKAAEAAAAMLSAGNNGRF 567 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDS+Y+P TG+I SPY+E GVLWKKPQK Sbjct: 568 MERTGSLDSSYNPATGRIGSPYNEDMDDDLLKKKNGNMLKKIGVLWKKPQK 618 >ref|XP_006488183.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Citrus sinensis] gi|568869964|ref|XP_006488184.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Citrus sinensis] gi|568869966|ref|XP_006488185.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X3 [Citrus sinensis] Length = 623 Score = 100 bits (249), Expect = 4e-19 Identities = 56/111 (50%), Positives = 63/111 (56%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSN+R ELRRLKVQSDQWRK +MLS GNNGK Sbjct: 513 EEADKSNRRAARMAEQLEAAQSANCEAEAELRRLKVQSDQWRKAAEAAASMLSTGNNGKC 572 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MER+GS+DSNY+P+TGKI PYS+ GVLWKKPQK Sbjct: 573 MERSGSIDSNYNPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKPQK 623 >ref|XP_006424657.1| hypothetical protein CICLE_v10027972mg [Citrus clementina] gi|557526591|gb|ESR37897.1| hypothetical protein CICLE_v10027972mg [Citrus clementina] Length = 658 Score = 100 bits (249), Expect = 4e-19 Identities = 56/111 (50%), Positives = 63/111 (56%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSN+R ELRRLKVQSDQWRK +MLS GNNGK Sbjct: 548 EEADKSNRRAARMAEQLEAAQSANCEAEAELRRLKVQSDQWRKAAEAAASMLSTGNNGKC 607 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MER+GS+DSNY+P+TGKI PYS+ GVLWKKPQK Sbjct: 608 MERSGSIDSNYNPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKPQK 658 >ref|XP_006424655.1| hypothetical protein CICLE_v10027972mg [Citrus clementina] gi|567864014|ref|XP_006424656.1| hypothetical protein CICLE_v10027972mg [Citrus clementina] gi|557526589|gb|ESR37895.1| hypothetical protein CICLE_v10027972mg [Citrus clementina] gi|557526590|gb|ESR37896.1| hypothetical protein CICLE_v10027972mg [Citrus clementina] Length = 623 Score = 100 bits (249), Expect = 4e-19 Identities = 56/111 (50%), Positives = 63/111 (56%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSN+R ELRRLKVQSDQWRK +MLS GNNGK Sbjct: 513 EEADKSNRRAARMAEQLEAAQSANCEAEAELRRLKVQSDQWRKAAEAAASMLSTGNNGKC 572 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MER+GS+DSNY+P+TGKI PYS+ GVLWKKPQK Sbjct: 573 MERSGSIDSNYNPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKPQK 623 >ref|XP_012064895.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Jatropha curcas] Length = 618 Score = 97.1 bits (240), Expect = 5e-18 Identities = 54/111 (48%), Positives = 65/111 (58%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEA++SNK+ ELR+LKVQSDQWRK AMLSAGNNGK+ Sbjct: 508 EEAERSNKKVGRVTEQLEAAQAANAEMEAELRKLKVQSDQWRKAAEAAAAMLSAGNNGKL 567 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDS+Y+PVTG + SPY++ GVLWK+PQK Sbjct: 568 MERTGSLDSSYNPVTGSMDSPYNDDTDDDLMRKKNGNMLKKIGVLWKRPQK 618 >ref|XP_008224813.1| PREDICTED: LOW QUALITY PROTEIN: interactor of constitutive active ROPs 3 [Prunus mume] Length = 609 Score = 97.1 bits (240), Expect = 5e-18 Identities = 57/111 (51%), Positives = 62/111 (55%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSNKR ELRRLKVQSDQWRK AMLSAGNNGK+ Sbjct: 499 EEADKSNKRVARVAEQLEAAQAANAEMEAELRRLKVQSDQWRKAAEAAAAMLSAGNNGKL 558 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 M+RT SLDS+++ VTGK SPYSE GV WKKPQK Sbjct: 559 MDRTASLDSSFNHVTGKFGSPYSEDMDDDLLKKKNGNMLKKIGVFWKKPQK 609 >ref|XP_012064892.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Jatropha curcas] gi|802551614|ref|XP_012064893.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Jatropha curcas] gi|802551616|ref|XP_012064894.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Jatropha curcas] gi|643738133|gb|KDP44121.1| hypothetical protein JCGZ_05588 [Jatropha curcas] Length = 619 Score = 97.1 bits (240), Expect = 5e-18 Identities = 54/111 (48%), Positives = 65/111 (58%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEA++SNK+ ELR+LKVQSDQWRK AMLSAGNNGK+ Sbjct: 509 EEAERSNKKVGRVTEQLEAAQAANAEMEAELRKLKVQSDQWRKAAEAAAAMLSAGNNGKL 568 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDS+Y+PVTG + SPY++ GVLWK+PQK Sbjct: 569 MERTGSLDSSYNPVTGSMDSPYNDDTDDDLMRKKNGNMLKKIGVLWKRPQK 619 >ref|XP_007204977.1| hypothetical protein PRUPE_ppa002832mg [Prunus persica] gi|462400619|gb|EMJ06176.1| hypothetical protein PRUPE_ppa002832mg [Prunus persica] Length = 629 Score = 97.1 bits (240), Expect = 5e-18 Identities = 57/111 (51%), Positives = 62/111 (55%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKSNKR ELRRLKVQSDQWRK AMLSAGNNGK+ Sbjct: 519 EEADKSNKRVARVAEQLEAAQAANAEMEAELRRLKVQSDQWRKAAEAAAAMLSAGNNGKL 578 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 M+RT SLDS+++ VTGK SPYSE GV WKKPQK Sbjct: 579 MDRTASLDSSFNHVTGKFGSPYSEDMDDDLLKKKNGNMLKKIGVFWKKPQK 629 >ref|XP_010104142.1| hypothetical protein L484_014428 [Morus notabilis] gi|587910712|gb|EXB98583.1| hypothetical protein L484_014428 [Morus notabilis] Length = 618 Score = 96.7 bits (239), Expect = 6e-18 Identities = 59/111 (53%), Positives = 63/111 (56%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEAD+S+KR ELRRLKVQSDQWRK +MLSAGNNGK Sbjct: 509 EEADRSHKRAARVTEQLEAAQAANAEMEAELRRLKVQSDQWRKAAEAAASMLSAGNNGKF 568 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 MERTGSLDSNY PV GKISS YS+ GVLWKKPQK Sbjct: 569 MERTGSLDSNYSPVAGKISSLYSD-DMDDILKKKNGNMLKKIGVLWKKPQK 618 >ref|XP_010651114.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vitis vinifera] Length = 625 Score = 95.5 bits (236), Expect = 1e-17 Identities = 55/111 (49%), Positives = 64/111 (57%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKS++R ELR+LKVQSDQWRK AMLSAG+NGK+ Sbjct: 515 EEADKSSRRAARVAEQLEATQVANSEMEAELRKLKVQSDQWRKAAEAAAAMLSAGSNGKL 574 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 E+TGSLDSNY+ +TGKI+SPYSE GVLWKKP K Sbjct: 575 TEKTGSLDSNYNHITGKITSPYSEDLDDESPKKKNGNVLKKIGVLWKKPHK 625 >ref|XP_010651109.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Vitis vinifera] gi|731392484|ref|XP_010651110.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Vitis vinifera] gi|731392486|ref|XP_010651111.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Vitis vinifera] gi|731392488|ref|XP_010651112.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Vitis vinifera] gi|731392490|ref|XP_010651113.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Vitis vinifera] Length = 626 Score = 95.5 bits (236), Expect = 1e-17 Identities = 55/111 (49%), Positives = 64/111 (57%) Frame = -2 Query: 369 EEADKSNKRXXXXXXXXXXXXXXXXXXXXELRRLKVQSDQWRKXXXXXXAMLSAGNNGKV 190 EEADKS++R ELR+LKVQSDQWRK AMLSAG+NGK+ Sbjct: 516 EEADKSSRRAARVAEQLEATQVANSEMEAELRKLKVQSDQWRKAAEAAAAMLSAGSNGKL 575 Query: 189 MERTGSLDSNYDPVTGKISSPYSEXXXXXXXXXXXXXXXXXXGVLWKKPQK 37 E+TGSLDSNY+ +TGKI+SPYSE GVLWKKP K Sbjct: 576 TEKTGSLDSNYNHITGKITSPYSEDLDDESPKKKNGNVLKKIGVLWKKPHK 626