BLASTX nr result
ID: Ziziphus21_contig00040802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040802 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002538339.1| conserved hypothetical protein [Ricinus comm... 100 5e-19 >ref|XP_002538339.1| conserved hypothetical protein [Ricinus communis] gi|223512664|gb|EEF24045.1| conserved hypothetical protein [Ricinus communis] Length = 153 Score = 100 bits (248), Expect = 5e-19 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -3 Query: 169 MDGTNQK*KSRKRSRETDRSATTRTRVGGVLSVSYHSCSGKDPQLSRGPPTARIT 5 MD TNQK KSRKRSR+TDRSATTRTRVG VLS+SYHSCSGKDPQLS+GPPTARIT Sbjct: 1 MDETNQKCKSRKRSRKTDRSATTRTRVGEVLSMSYHSCSGKDPQLSKGPPTARIT 55