BLASTX nr result
ID: Ziziphus21_contig00040789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040789 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFL06024.1| conserved hypothetical protein [Streptomyces sp. ... 49 2e-08 gb|EFE81974.1| LOW QUALITY PROTEIN: conserved hypothetical prote... 55 2e-06 >gb|EFL06024.1| conserved hypothetical protein [Streptomyces sp. AA4] Length = 195 Score = 49.3 bits (116), Expect(2) = 2e-08 Identities = 26/50 (52%), Positives = 26/50 (52%) Frame = +3 Query: 117 RICLRNALRPCPSITTDWYDYLPASPHRLTTTSSGRALHFSFPKESEALG 266 RICL L T W YLPASPHRLTTT SG LH P E G Sbjct: 40 RICLLFLLHAYTRTTIAWRSYLPASPHRLTTTESGPTLHTPDPPEGFTSG 89 Score = 35.8 bits (81), Expect(2) = 2e-08 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = +1 Query: 34 LARGFSWQHRIIEFASIGYASVLR 105 L RGFS QHRI FAS GYAS LR Sbjct: 12 LTRGFSRQHRITHFASHGYASRLR 35 >gb|EFE81974.1| LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces albus J1074] Length = 89 Score = 55.1 bits (131), Expect(2) = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +2 Query: 32 SSLEAFLGSIGSSNSPQSAMRRFSGTCYADLPT*RPTTLPQYYH 163 +SLEAFL SIGSS SPQSA + S TC DLP RPT LP+ H Sbjct: 1 NSLEAFLDSIGSSTSPQSARHQVSATCTTDLPIARPTPLPRDNH 44 Score = 23.1 bits (48), Expect(2) = 2e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 169 GTTTFLRHPI 198 G TTFLRHPI Sbjct: 47 GWTTFLRHPI 56