BLASTX nr result
ID: Ziziphus21_contig00040635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040635 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 110 5e-22 emb|CDY71656.1| BnaUnng04510D [Brassica napus] 75 9e-14 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 76 9e-12 gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sa... 76 1e-11 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756... 74 4e-11 ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscy... 74 4e-11 ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 74 4e-11 ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsic... 74 4e-11 gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum an... 74 4e-11 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 74 4e-11 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 73 1e-10 pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 72 1e-10 ref|YP_009153938.1| ribosomal protein L2 (mitochondrion) [Gossyp... 72 1e-10 ref|XP_012482057.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 72 1e-10 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 72 1e-10 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 72 1e-10 ref|YP_009177628.1| ribosomal protein L2 (mitochondrion) [Gossyp... 72 1e-10 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 70 5e-10 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 70 8e-10 ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriod... 69 1e-09 >ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like [Solanum tuberosum] Length = 340 Score = 110 bits (274), Expect = 5e-22 Identities = 54/61 (88%), Positives = 56/61 (91%) Frame = -2 Query: 183 KFLGRAVRGSSRTVREPSPSTGA*VNTYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQN 4 KFLGRAVR SS TVREPSP GA VNTYIIASHQLEAGKMVMNC+WSKPSTSDLL+PAQN Sbjct: 277 KFLGRAVRDSSHTVREPSPCAGAXVNTYIIASHQLEAGKMVMNCDWSKPSTSDLLQPAQN 336 Query: 3 A 1 A Sbjct: 337 A 337 >emb|CDY71656.1| BnaUnng04510D [Brassica napus] Length = 104 Score = 74.7 bits (182), Expect(2) = 9e-14 Identities = 40/64 (62%), Positives = 42/64 (65%) Frame = -2 Query: 195 RGGFKFLGRAVRGSSRTVREPSPSTGA*VNTYIIASHQLEAGKMVMNCNWSKPSTSDLLR 16 RGGFKFLGRAV NTYIIASHQLEAGKMVMNC+WSKPSTS + Sbjct: 50 RGGFKFLGRAV------------------NTYIIASHQLEAGKMVMNCDWSKPSTSSFSQ 91 Query: 15 PAQN 4 AQN Sbjct: 92 SAQN 95 Score = 28.5 bits (62), Expect(2) = 9e-14 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 304 AKKSRNEAASLIAP 263 +KKSRNEAASLIAP Sbjct: 24 SKKSRNEAASLIAP 37 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 111 VNTYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 VNTYIIASHQLEAGKMVMNC+WSKPSTSDLLRPA+NA Sbjct: 297 VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPARNA 333 >gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sativa] Length = 337 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA Sbjct: 300 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 334 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756762100|gb|AJM70209.1| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] Length = 331 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 294 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 328 >ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] gi|756142178|gb|AJK91389.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] Length = 331 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 294 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 328 >ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial, partial [Solanum lycopersicum] Length = 323 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 286 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 320 >ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] gi|667752052|gb|AIG90138.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 332 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 295 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 329 >gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 329 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 292 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 326 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 294 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 328 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASH+LEAGKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 298 TYIIASHELEAGKMVMNCDWSKPSTSDLLRPAQNA 332 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSD LRPAQNA Sbjct: 295 TYIIASHQLEAGKMVMNCDWSKPSTSDFLRPAQNA 329 >ref|YP_009153938.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] gi|430728017|gb|AGA54174.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLE GKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 297 TYIIASHQLETGKMVMNCDWSKPSTSDLLRPAQNA 331 >ref|XP_012482057.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial [Gossypium raimondii] Length = 334 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLE GKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 297 TYIIASHQLETGKMVMNCDWSKPSTSDLLRPAQNA 331 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQN 4 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQN Sbjct: 298 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQN 331 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPA+NA Sbjct: 297 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPARNA 331 >ref|YP_009177628.1| ribosomal protein L2 (mitochondrion) [Gossypium barbadense] gi|397911886|gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] gi|887515761|gb|AKQ51133.1| ribosomal protein L2 (mitochondrion) [Gossypium barbadense] Length = 334 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYIIASHQLE GKMVMNC+WSKPSTSDLLRPAQNA Sbjct: 297 TYIIASHQLETGKMVMNCDWSKPSTSDLLRPAQNA 331 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 111 VNTYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 VNTYI+ASHQLEAGKMVMNC+WSKPS S LRPAQNA Sbjct: 335 VNTYILASHQLEAGKMVMNCDWSKPSKSGFLRPAQNA 371 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQN 4 TY+IA HQLEAGKMVMNC+WSKPSTSDLLRPAQN Sbjct: 295 TYLIACHQLEAGKMVMNCDWSKPSTSDLLRPAQN 328 >ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] gi|480541934|gb|AGJ90427.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] Length = 554 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 105 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNA 1 TYI+ASHQLEAGKMVMNC+WSKPSTS LRPAQNA Sbjct: 333 TYILASHQLEAGKMVMNCDWSKPSTSGFLRPAQNA 367