BLASTX nr result
ID: Ziziphus21_contig00040480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040480 (196 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008366244.1| PREDICTED: (R)-mandelonitrile lyase 2-like [... 59 1e-06 ref|XP_009391169.1| PREDICTED: (R)-mandelonitrile lyase-like [Mu... 57 7e-06 ref|XP_004507539.1| PREDICTED: (R)-mandelonitrile lyase-like [Ci... 57 7e-06 >ref|XP_008366244.1| PREDICTED: (R)-mandelonitrile lyase 2-like [Malus domestica] Length = 550 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -3 Query: 194 SIFNTSPGTNPQATLMMIGRYIGLKMLQEREAA 96 SIFN+SPGTNPQATLMM+GRY+GL++L+ER A+ Sbjct: 515 SIFNSSPGTNPQATLMMLGRYVGLRILEERSAS 547 >ref|XP_009391169.1| PREDICTED: (R)-mandelonitrile lyase-like [Musa acuminata subsp. malaccensis] Length = 556 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 194 SIFNTSPGTNPQATLMMIGRYIGLKMLQERE 102 S F SPGTNPQAT+MM+GRY+GLKMLQERE Sbjct: 525 STFRVSPGTNPQATVMMMGRYVGLKMLQERE 555 >ref|XP_004507539.1| PREDICTED: (R)-mandelonitrile lyase-like [Cicer arietinum] Length = 580 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 194 SIFNTSPGTNPQATLMMIGRYIGLKMLQERE 102 S+F+ SPGTNPQATLMM+GRY GLKM++ERE Sbjct: 544 SVFSVSPGTNPQATLMMLGRYFGLKMIRERE 574