BLASTX nr result
ID: Ziziphus21_contig00040404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040404 (219 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010090793.1| hypothetical protein L484_009071 [Morus nota... 68 2e-09 >ref|XP_010090793.1| hypothetical protein L484_009071 [Morus notabilis] gi|587850653|gb|EXB40826.1| hypothetical protein L484_009071 [Morus notabilis] Length = 508 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 6/78 (7%) Frame = -2 Query: 218 ERRTCTLEDEVEIPDFPEEADFICSPKKG------NNVLPEVSHTLGDKKFEKDAVCSLR 57 E R+ ED+VE+P+F +E D +C P+K NNVLP++S +G KKF D++ + Sbjct: 95 EPRSSNCEDDVEMPNFYDEGDSVCPPEKAISKDEENNVLPKLSARVGAKKFSDDSLLRVG 154 Query: 56 SEKLGRSYPWSAATKEAE 3 EK G + WS+A+KEAE Sbjct: 155 IEKQGSLFSWSSASKEAE 172