BLASTX nr result
ID: Ziziphus21_contig00040089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040089 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009176046.1| hypothetical chloroplast RF21 (chloroplast) ... 145 9e-33 gb|ALB78334.1| hypothetical chloroplast RF2 (chloroplast) [Heuch... 145 9e-33 ref|YP_009170469.1| hypothetical chloroplast RF21 (chloroplast) ... 145 9e-33 ref|YP_009166167.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] g... 145 9e-33 ref|XP_010088418.1| Protein ycf2 [Morus notabilis] gi|587949978|... 145 9e-33 ref|YP_009139722.1| hypothetical chloroplast RF21 (chloroplast) ... 145 9e-33 ref|YP_009110396.1| hypothetical chloroplast RF21 (chloroplast) ... 145 9e-33 ref|YP_009107019.1| hypothetical chloroplast RF2 (chloroplast) [... 145 9e-33 ref|YP_009059392.1| hypothetical chloroplast RF21 (chloroplast) ... 145 9e-33 ref|YP_009040250.1| hypothetical chloroplast RF2 [Fragaria iinum... 145 9e-33 gb|ADD30901.1| putative RF2 protein (chloroplast) [Trochodendron... 145 9e-33 gb|ADD30900.1| putative RF2 protein (chloroplast) [Staphylea col... 145 9e-33 gb|ADD30897.1| putative RF2 protein (chloroplast) [Oxalis latifo... 145 9e-33 gb|ADD30895.1| putative RF2 protein (chloroplast) [Heuchera sang... 145 9e-33 gb|ADD30893.1| putative RF2 protein (chloroplast) [Ficus sp. Moo... 145 9e-33 gb|ADD30890.1| putative RF2 protein (chloroplast) [Berberidopsis... 145 9e-33 gb|ADB24086.1| Ycf2 (chloroplast) [Cynomorium coccineum subsp. s... 145 9e-33 ref|YP_002720155.1| ycf2 [Jatropha curcas] gi|225544184|ref|YP_0... 145 9e-33 ref|YP_009019931.1| hypothetical chloroplast RF21 (chloroplast) ... 145 9e-33 ref|YP_009019835.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|5... 145 9e-33 >ref|YP_009176046.1| hypothetical chloroplast RF21 (chloroplast) [Ficus racemosa] gi|944542146|ref|YP_009176066.1| hypothetical chloroplast RF21 (chloroplast) [Ficus racemosa] gi|937500983|gb|ALI30742.1| hypothetical chloroplast RF21 (chloroplast) [Ficus racemosa] gi|937501003|gb|ALI30762.1| hypothetical chloroplast RF21 (chloroplast) [Ficus racemosa] Length = 2290 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1754 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1813 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1814 QRKHFFTLSYT 1824 >gb|ALB78334.1| hypothetical chloroplast RF2 (chloroplast) [Heuchera parviflora var. saurensis] gi|924443805|gb|ALB78335.1| hypothetical chloroplast RF2 (chloroplast) [Heuchera parviflora var. saurensis] Length = 2292 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1762 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1821 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1822 QRKHFFTLSYT 1832 >ref|YP_009170469.1| hypothetical chloroplast RF21 (chloroplast) [Humulus lupulus] gi|937547522|ref|YP_009170485.1| hypothetical chloroplast RF21 (chloroplast) [Humulus lupulus] gi|927682726|gb|ALE29465.1| hypothetical chloroplast RF21 (chloroplast) [Humulus lupulus] gi|927682743|gb|ALE29482.1| hypothetical chloroplast RF21 (chloroplast) [Humulus lupulus] Length = 2287 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1748 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1807 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1808 QRKHFFTLSYT 1818 >ref|YP_009166167.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] gi|937407990|ref|YP_009166187.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] gi|918056467|gb|AKZ89364.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] gi|918056487|gb|AKZ89384.1| Ycf2 (chloroplast) [Zanthoxylum piperitum] Length = 2284 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1752 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1811 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1812 QRKHFFTLSYT 1822 >ref|XP_010088418.1| Protein ycf2 [Morus notabilis] gi|587949978|gb|EXC35992.1| Protein ycf2 [Morus notabilis] Length = 544 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 430 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 489 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 490 QRKHFFTLSYT 500 >ref|YP_009139722.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] gi|821318616|ref|YP_009139739.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] gi|818638163|gb|AKF34029.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] gi|818638168|gb|AKF34028.1| hypothetical chloroplast RF21 (chloroplast) [Morus notabilis] Length = 2292 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1753 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1812 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1813 QRKHFFTLSYT 1823 >ref|YP_009110396.1| hypothetical chloroplast RF21 (chloroplast) [Morus mongolica] Length = 2294 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1755 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1814 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1815 QRKHFFTLSYT 1825 >ref|YP_009107019.1| hypothetical chloroplast RF2 (chloroplast) [Sapindus mukorossi] gi|725797395|ref|YP_009107037.1| hypothetical chloroplast RF2 (chloroplast) [Sapindus mukorossi] gi|698352414|gb|AIT96765.1| hypothetical chloroplast RF2 (chloroplast) [Sapindus mukorossi] gi|698352432|gb|AIT96783.1| hypothetical chloroplast RF2 (chloroplast) [Sapindus mukorossi] Length = 2292 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1760 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1819 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1820 QRKHFFTLSYT 1830 >ref|YP_009059392.1| hypothetical chloroplast RF21 (chloroplast) [Citrus aurantiifolia] gi|697964829|ref|YP_009059416.1| hypothetical chloroplast RF21 (chloroplast) [Citrus aurantiifolia] gi|675269938|gb|AIL50329.1| hypothetical chloroplast RF21 (chloroplast) [Citrus aurantiifolia] gi|675269962|gb|AIL50353.1| hypothetical chloroplast RF21 (chloroplast) [Citrus aurantiifolia] Length = 2282 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1750 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1809 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1810 QRKHFFTLSYT 1820 >ref|YP_009040250.1| hypothetical chloroplast RF2 [Fragaria iinumae] gi|657171786|ref|YP_009040268.1| hypothetical chloroplast RF2 [Fragaria iinumae] gi|511265987|gb|AGN72093.1| hypothetical chloroplast RF2 [Fragaria iinumae] gi|511266005|gb|AGN72111.1| hypothetical chloroplast RF2 [Fragaria iinumae] gi|823334412|gb|AKI31125.1| Ycf2 (chloroplast) [Fragaria iinumae] Length = 2275 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1746 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1805 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1806 QRKHFFTLSYT 1816 >gb|ADD30901.1| putative RF2 protein (chloroplast) [Trochodendron aralioides] Length = 2293 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1761 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1820 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1821 QRKHFFTLSYT 1831 >gb|ADD30900.1| putative RF2 protein (chloroplast) [Staphylea colchica] gi|340807116|gb|AEK71716.1| hypothetical chloroplast RF2 [Staphylea colchica] Length = 2285 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1753 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1812 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1813 QRKHFFTLSYT 1823 >gb|ADD30897.1| putative RF2 protein (chloroplast) [Oxalis latifolia] gi|340807132|gb|AEK71730.1| hypothetical chloroplast RF2 [Oxalis latifolia] Length = 2280 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1750 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1809 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1810 QRKHFFTLSYT 1820 >gb|ADD30895.1| putative RF2 protein (chloroplast) [Heuchera sanguinea] gi|340807140|gb|AEK71737.1| hypothetical chloroplast RF2 [Heuchera sanguinea] Length = 2290 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1760 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1819 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1820 QRKHFFTLSYT 1830 >gb|ADD30893.1| putative RF2 protein (chloroplast) [Ficus sp. Moore 315] gi|340807156|gb|AEK71751.1| hypothetical chloroplast RF2 [Ficus sp. M. J. Moore 315] Length = 2289 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1755 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1814 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1815 QRKHFFTLSYT 1825 >gb|ADD30890.1| putative RF2 protein (chloroplast) [Berberidopsis corallina] gi|340807100|gb|AEK71702.1| hypothetical chloroplast RF2 [Berberidopsis corallina] Length = 2298 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1766 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1825 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1826 QRKHFFTLSYT 1836 >gb|ADB24086.1| Ycf2 (chloroplast) [Cynomorium coccineum subsp. songaricum] Length = 2288 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1761 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1820 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1821 QRKHFFTLSYT 1831 >ref|YP_002720155.1| ycf2 [Jatropha curcas] gi|225544184|ref|YP_002720174.1| ycf2 [Jatropha curcas] gi|224979607|gb|ACN72734.1| ycf2 [Jatropha curcas] gi|224979625|gb|ACN72752.1| ycf2 [Jatropha curcas] Length = 2298 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1768 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1827 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1828 QRKHFFTLSYT 1838 >ref|YP_009019931.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] gi|595789742|ref|YP_009019949.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] gi|586947578|gb|AHJ91361.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] gi|586947597|gb|AHJ91380.1| hypothetical chloroplast RF21 (chloroplast) [Azadirachta indica] Length = 2275 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1743 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1802 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1803 QRKHFFTLSYT 1813 >ref|YP_009019835.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|595789657|ref|YP_009019852.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|586947457|gb|AHJ91254.1| Ycf2 (chloroplast) [Vitis rotundifolia] gi|586947474|gb|AHJ91271.1| Ycf2 (chloroplast) [Vitis rotundifolia] Length = 2300 Score = 145 bits (367), Expect = 9e-33 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = -2 Query: 215 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 36 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ Sbjct: 1768 SNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQ 1827 Query: 35 QRKHFFTLSYT 3 QRKHFFTLSYT Sbjct: 1828 QRKHFFTLSYT 1838