BLASTX nr result
ID: Ziziphus21_contig00039460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039460 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008244827.1| PREDICTED: putative F-box protein At2g04810 ... 64 4e-08 ref|XP_007208503.1| hypothetical protein PRUPE_ppa026622mg, part... 63 1e-07 >ref|XP_008244827.1| PREDICTED: putative F-box protein At2g04810 [Prunus mume] Length = 374 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = -2 Query: 182 FFNFAEQKCYKIKTIFHQSGLQFDSPWIAGSSYGWLIIFDKMFNRCLLNPFSGARIELP 6 F++F E+K Y I++ F FD+ W GSS+GWL+I DK N LLNP SG RI+LP Sbjct: 37 FYSFQEKKLYTIESAFQD----FDNAWCVGSSHGWLVILDKRANPHLLNPISGRRIQLP 91 >ref|XP_007208503.1| hypothetical protein PRUPE_ppa026622mg, partial [Prunus persica] gi|462404145|gb|EMJ09702.1| hypothetical protein PRUPE_ppa026622mg, partial [Prunus persica] Length = 390 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = -2 Query: 182 FFNFAEQKCYKIKTIFHQSGLQFDSPWIAGSSYGWLIIFDKMFNRCLLNPFSGARIELP 6 F++F E+K Y I+ F FD+ W GSS+GWL+I DK N LLNP SG RI+LP Sbjct: 66 FYSFQEKKLYTIEGAFQD----FDNAWCVGSSHGWLVILDKRANPHLLNPISGRRIQLP 120