BLASTX nr result
ID: Ziziphus21_contig00039202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039202 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008389166.1| PREDICTED: CRAL-TRIO domain-containing prote... 57 4e-06 ref|XP_008389165.1| PREDICTED: CRAL-TRIO domain-containing prote... 57 4e-06 emb|CBI26823.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_003631185.1| PREDICTED: SEC14 cytosolic factor [Vitis vin... 57 4e-06 dbj|BAF46310.1| SEC14 cytosolic factor / phosphoglyceride transf... 56 9e-06 >ref|XP_008389166.1| PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X2 [Malus domestica] Length = 242 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 317 RKIYLQRLSKNGYPVMIV*ASNHFPAKDQLQFKQ 216 RKI+LQ LSK+GYPVM+V AS HFP+KDQLQFK+ Sbjct: 76 RKIFLQGLSKDGYPVMVVKASKHFPSKDQLQFKK 109 >ref|XP_008389165.1| PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X1 [Malus domestica] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 317 RKIYLQRLSKNGYPVMIV*ASNHFPAKDQLQFKQ 216 RKI+LQ LSK+GYPVM+V AS HFP+KDQLQFK+ Sbjct: 77 RKIFLQGLSKDGYPVMVVKASKHFPSKDQLQFKK 110 >emb|CBI26823.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 317 RKIYLQRLSKNGYPVMIV*ASNHFPAKDQLQFKQ 216 RKIYLQ LSKNGYPVMIV A HFP+KD LQFK+ Sbjct: 77 RKIYLQGLSKNGYPVMIVKACKHFPSKDHLQFKK 110 >ref|XP_003631185.1| PREDICTED: SEC14 cytosolic factor [Vitis vinifera] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 317 RKIYLQRLSKNGYPVMIV*ASNHFPAKDQLQFKQ 216 RKIYLQ LSKNGYPVMIV A HFP+KD LQFK+ Sbjct: 77 RKIYLQGLSKNGYPVMIVKACKHFPSKDHLQFKK 110 >dbj|BAF46310.1| SEC14 cytosolic factor / phosphoglyceride transfer family protein [Ipomoea nil] Length = 246 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 317 RKIYLQRLSKNGYPVMIV*ASNHFPAKDQLQFKQ 216 RKI LQ LSKNG+PVMIV NHFPAKDQLQFK+ Sbjct: 78 RKICLQGLSKNGFPVMIVKGRNHFPAKDQLQFKK 111