BLASTX nr result
ID: Ziziphus21_contig00039197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039197 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011319169.1| hypothetical protein FGSG_10222 [Fusarium gr... 116 6e-24 gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxyspor... 115 1e-23 ref|XP_008099078.1| hypothetical protein GLRG_10202 [Colletotric... 115 1e-23 ref|XP_007746200.1| plasma membrane proteolipid 3 [Cladophialoph... 115 1e-23 ref|XP_007598233.1| plasma membrane proteolipid 3 [Colletotrichu... 115 1e-23 gb|KPI43274.1| Plasma membrane proteolipid 3 [Phialophora attae] 115 2e-23 gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys c... 114 2e-23 ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melam... 114 2e-23 ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI... 114 3e-23 ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] ... 113 5e-23 emb|CRK30824.1| hypothetical protein BN1708_005265 [Verticillium... 113 6e-23 gb|KIJ34665.1| hypothetical protein M422DRAFT_181886 [Sphaerobol... 113 6e-23 gb|EMS19696.1| stress response RCI peptide, putative [Rhodospori... 113 6e-23 ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia... 113 6e-23 ref|XP_001547873.1| conserved hypothetical protein [Botrytis cin... 112 8e-23 gb|KNE94516.1| plasma membrane proteolipid 3 [Puccinia striiform... 112 1e-22 ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe o... 112 1e-22 gb|KNZ59020.1| putative stress response RCI peptide [Puccinia so... 111 2e-22 ref|XP_013245259.1| UPF0057-domain-containing protein [Tilletiar... 111 2e-22 gb|KDE06194.1| hypothetical protein MVLG_03475 [Microbotryum lyc... 111 2e-22 >ref|XP_011319169.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|410516918|sp|Q4HXT6.2|PMP3_GIBZE RecName: Full=Plasma membrane proteolipid 3 gi|558866824|gb|ESU16907.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|596545806|gb|EYB25849.1| hypothetical protein FG05_10222 [Fusarium graminearum] gi|699044605|emb|CEF75592.1| unnamed protein product [Fusarium graminearum] Length = 57 Score = 116 bits (291), Expect = 6e-24 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAIILPP+GVFLERGCGADFFINILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxysporum Fo5176] gi|517317170|emb|CCT69344.1| probable RIC1 protein [Fusarium fujikuroi IMI 58289] gi|584131311|gb|EWG40705.1| plasma membrane proteolipid 3 [Fusarium verticillioides 7600] gi|587668050|gb|EWY90391.1| plasma membrane proteolipid 3 [Fusarium oxysporum FOSC 3-a] gi|587690392|gb|EWZ36997.1| plasma membrane proteolipid 3 [Fusarium oxysporum Fo47] gi|587719003|gb|EWZ90340.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746858|gb|EXA44574.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037174|gb|EXK39032.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. melonis 26406] gi|590063000|gb|EXK90524.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. raphani 54005] gi|591421327|gb|EXL56464.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452771|gb|EXL85065.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470692|gb|EXM01996.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503744|gb|EXM33089.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|829110287|gb|KLO86824.1| putative RIC1 protein [Fusarium fujikuroi] gi|829112645|gb|KLO89093.1| Uncharacterized protein LW93_12514 [Fusarium fujikuroi] gi|829142269|gb|KLP14054.1| Uncharacterized protein LW94_7022 [Fusarium fujikuroi] gi|902730533|gb|KNB02102.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 57 Score = 115 bits (289), Expect = 1e-23 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKI+LAIILPP+GVFLERGCGADFFINILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >ref|XP_008099078.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|310800165|gb|EFQ35058.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|530463481|gb|EQB46149.1| hypothetical protein CGLO_14841 [Colletotrichum gloeosporioides Cg-14] gi|640924637|gb|KDN68644.1| hypothetical protein CSUB01_03103 [Colletotrichum sublineola] Length = 57 Score = 115 bits (289), Expect = 1e-23 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAIILPP+GVFLERGCGADFFINILLTILGY+PGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 57 >ref|XP_007746200.1| plasma membrane proteolipid 3 [Cladophialophora psammophila CBS 110553] gi|915065618|ref|XP_013272584.1| plasma membrane proteolipid 3 [Rhinocladiella mackenziei CBS 650.93] gi|915187266|ref|XP_013318828.1| plasma membrane proteolipid 3 [Exophiala xenobiotica] gi|589986401|gb|EXJ69385.1| plasma membrane proteolipid 3 [Cladophialophora psammophila CBS 110553] gi|759206605|gb|KIV84024.1| plasma membrane proteolipid 3 [Exophiala sideris] gi|759220337|gb|KIV97674.1| plasma membrane proteolipid 3 [Exophiala mesophila] gi|759237435|gb|KIW14380.1| plasma membrane proteolipid 3 [Exophiala spinifera] gi|759281741|gb|KIW58244.1| plasma membrane proteolipid 3 [Exophiala xenobiotica] gi|759317039|gb|KIW93388.1| plasma membrane proteolipid 3 [Cladophialophora bantiana CBS 173.52] gi|759329120|gb|KIX05448.1| plasma membrane proteolipid 3 [Rhinocladiella mackenziei CBS 650.93] gi|761334827|gb|KIX96385.1| plasma membrane proteolipid 3 [Fonsecaea multimorphosa CBS 102226] Length = 57 Score = 115 bits (288), Expect = 1e-23 Identities = 56/57 (98%), Positives = 56/57 (98%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAIILPPLGVFLERGC ADFFINILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLTILGYIPGIIHALYIILKY 57 >ref|XP_007598233.1| plasma membrane proteolipid 3 [Colletotrichum fioriniae PJ7] gi|380488434|emb|CCF37378.1| plasma membrane proteolipid 3 [Colletotrichum higginsianum] gi|588896715|gb|EXF78143.1| plasma membrane proteolipid 3 [Colletotrichum fioriniae PJ7] gi|666406799|gb|KEY72023.1| hypothetical protein S7711_00042 [Stachybotrys chartarum IBT 7711] Length = 57 Score = 115 bits (288), Expect = 1e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILA+ILPP+GVFLERGCGADFFINILLTILGY+PGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAVILPPVGVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 57 >gb|KPI43274.1| Plasma membrane proteolipid 3 [Phialophora attae] Length = 57 Score = 115 bits (287), Expect = 2e-23 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAI+LPPLGVFLERGC ADFFINILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIVLPPLGVFLERGCNADFFINILLTILGYIPGIIHALYIILKY 57 >gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys chlorohalonata IBT 40285] Length = 57 Score = 114 bits (286), Expect = 2e-23 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILA++LPP+GVFLERGCGADFFINILLTILGY+PGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAVLLPPVGVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 57 >ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] gi|328859168|gb|EGG08278.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] Length = 57 Score = 114 bits (286), Expect = 2e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKI+LAI+LPPLGVFLERGCGADF+INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKILLAIVLPPLGVFLERGCGADFWINILLTILGYIPGIIHALYIILKY 57 >ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256731818|gb|EEU45167.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 57 Score = 114 bits (285), Expect = 3e-23 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAIILPP+GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] gi|340515326|gb|EGR45581.1| predicted protein [Trichoderma reesei QM6a] gi|572275412|gb|ETR98847.1| UPF0057-domain-containing protein [Trichoderma reesei RUT C-30] Length = 57 Score = 113 bits (283), Expect = 5e-23 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKI+LAIILPP+GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >emb|CRK30824.1| hypothetical protein BN1708_005265 [Verticillium longisporum] Length = 386 Score = 113 bits (282), Expect = 6e-23 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +3 Query: 87 SVKMPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 +V MPFTASDICKI+LAIILPP+GVFLERGCGAD INILLTILGYIPGIIHALYIILKY Sbjct: 327 TVNMPFTASDICKILLAIILPPVGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 386 >gb|KIJ34665.1| hypothetical protein M422DRAFT_181886 [Sphaerobolus stellatus SS14] Length = 57 Score = 113 bits (282), Expect = 6e-23 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MP TASDICKII AIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY Sbjct: 1 MPATASDICKIIFAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >gb|EMS19696.1| stress response RCI peptide, putative [Rhodosporidium toruloides NP11] gi|647395037|emb|CDR36273.1| RHTO0S01e18030g1_1 [Rhodosporidium toruloides] Length = 57 Score = 113 bits (282), Expect = 6e-23 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAIILPPLGVFLERGC ADF+IN+LLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFWINVLLTILGYIPGIIHALYIILKY 57 >ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980] gi|154694724|gb|EDN94462.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980 UF-70] Length = 57 Score = 113 bits (282), Expect = 6e-23 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAIILPPLGVFLERGCGAD INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_001547873.1| conserved hypothetical protein [Botrytis cinerea B05.10] gi|347835463|emb|CCD50035.1| similar to stress response RCI peptide [Botrytis cinerea T4] Length = 57 Score = 112 bits (281), Expect = 8e-23 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILA+ILPPLGVFLERGCGAD INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAVILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >gb|KNE94516.1| plasma membrane proteolipid 3 [Puccinia striiformis f. sp. tritici PST-78] Length = 57 Score = 112 bits (279), Expect = 1e-22 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAI+LPPLGVFLERGC ADF+INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIVLPPLGVFLERGCVADFWINILLTILGYIPGIIHALYIILKY 57 >ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|351639495|gb|EHA47359.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|440472934|gb|ELQ41764.1| hypothetical protein OOU_Y34scaffold00255g62 [Magnaporthe oryzae Y34] gi|440478702|gb|ELQ59512.1| hypothetical protein OOW_P131scaffold01349g18 [Magnaporthe oryzae P131] Length = 57 Score = 112 bits (279), Expect = 1e-22 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILA+ILPPLGVF+ERGCGAD INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAVILPPLGVFMERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >gb|KNZ59020.1| putative stress response RCI peptide [Puccinia sorghi] Length = 57 Score = 111 bits (278), Expect = 2e-22 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKIILAI+LPPLGVFLERGC ADF+INILLTILGY PGIIHALYIILKY Sbjct: 1 MPFTASDICKIILAIVLPPLGVFLERGCNADFWINILLTILGYFPGIIHALYIILKY 57 >ref|XP_013245259.1| UPF0057-domain-containing protein [Tilletiaria anomala UBC 951] gi|639575048|gb|KDN52400.1| UPF0057-domain-containing protein [Tilletiaria anomala UBC 951] Length = 57 Score = 111 bits (278), Expect = 2e-22 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = +3 Query: 96 MPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 266 MPFTASDICKII A+ILPPLGVFLERGC ADF+INILLTILGYIPGIIHALYIILKY Sbjct: 1 MPFTASDICKIIFAVILPPLGVFLERGCAADFWINILLTILGYIPGIIHALYIILKY 57 >gb|KDE06194.1| hypothetical protein MVLG_03475 [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 122 Score = 111 bits (278), Expect = 2e-22 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +3 Query: 81 SHSVKMPFTASDICKIILAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIIL 260 ++S MPFTASDICKIILAI LPPLGVFLERGC ADF+IN++LTILGYIPGI+HALYIIL Sbjct: 61 NNSSAMPFTASDICKIILAIFLPPLGVFLERGCNADFWINVILTILGYIPGIVHALYIIL 120 Query: 261 KY 266 KY Sbjct: 121 KY 122