BLASTX nr result
ID: Ziziphus21_contig00039189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039189 (200 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014502083.1| PREDICTED: probable polyamine oxidase 5 [Vig... 67 5e-09 gb|KOM39894.1| hypothetical protein LR48_Vigan04g009200 [Vigna a... 67 5e-09 ref|XP_010090043.1| putative polyamine oxidase 5 [Morus notabili... 67 5e-09 ref|XP_002309226.1| hypothetical protein POPTR_0006s15580g [Popu... 67 5e-09 ref|XP_007138729.1| hypothetical protein PHAVU_009G232400g [Phas... 67 5e-09 ref|XP_007201933.1| hypothetical protein PRUPE_ppa003540mg [Prun... 67 5e-09 ref|XP_007154659.1| hypothetical protein PHAVU_003G136900g [Phas... 66 9e-09 ref|XP_007012841.1| Polyamine oxidase 5 [Theobroma cacao] gi|508... 66 9e-09 ref|XP_004307224.1| PREDICTED: probable polyamine oxidase 5 [Fra... 66 9e-09 ref|XP_014508345.1| PREDICTED: probable polyamine oxidase 5 [Vig... 66 1e-08 gb|KOM29612.1| hypothetical protein LR48_Vigan728s003500 [Vigna ... 66 1e-08 gb|KHN24608.1| Putative polyamine oxidase 5 [Glycine soja] 66 1e-08 gb|KHN17669.1| Putative polyamine oxidase 5 [Glycine soja] 66 1e-08 gb|KHN06611.1| Putative polyamine oxidase 5 [Glycine soja] gi|94... 66 1e-08 ref|XP_010047573.1| PREDICTED: probable polyamine oxidase 5 [Euc... 66 1e-08 ref|XP_002514111.1| conserved hypothetical protein [Ricinus comm... 66 1e-08 ref|XP_006587008.1| PREDICTED: probable polyamine oxidase 5-like... 66 1e-08 ref|XP_006346568.1| PREDICTED: probable polyamine oxidase 5-like... 66 1e-08 ref|XP_003550632.1| PREDICTED: probable polyamine oxidase 5-like... 66 1e-08 ref|XP_003546459.1| PREDICTED: probable polyamine oxidase 5-like... 66 1e-08 >ref|XP_014502083.1| PREDICTED: probable polyamine oxidase 5 [Vigna radiata var. radiata] Length = 572 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGGSRIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 68 >gb|KOM39894.1| hypothetical protein LR48_Vigan04g009200 [Vigna angularis] Length = 558 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGGSRIGGRINTSEFGGDRIEMGATWIHG Sbjct: 25 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 54 >ref|XP_010090043.1| putative polyamine oxidase 5 [Morus notabilis] gi|587848581|gb|EXB38840.1| putative polyamine oxidase 5 [Morus notabilis] Length = 561 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGGSRIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_002309226.1| hypothetical protein POPTR_0006s15580g [Populus trichocarpa] gi|222855202|gb|EEE92749.1| hypothetical protein POPTR_0006s15580g [Populus trichocarpa] Length = 554 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGGSRIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_007138729.1| hypothetical protein PHAVU_009G232400g [Phaseolus vulgaris] gi|561011816|gb|ESW10723.1| hypothetical protein PHAVU_009G232400g [Phaseolus vulgaris] Length = 571 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGGSRIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_007201933.1| hypothetical protein PRUPE_ppa003540mg [Prunus persica] gi|462397464|gb|EMJ03132.1| hypothetical protein PRUPE_ppa003540mg [Prunus persica] Length = 567 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGGSRIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_007154659.1| hypothetical protein PHAVU_003G136900g [Phaseolus vulgaris] gi|561028013|gb|ESW26653.1| hypothetical protein PHAVU_003G136900g [Phaseolus vulgaris] Length = 537 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 128 MAYDEGVLEPWDVEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 ++ + + E VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 27 VSVSKSLFEVCVVEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_007012841.1| Polyamine oxidase 5 [Theobroma cacao] gi|508783204|gb|EOY30460.1| Polyamine oxidase 5 [Theobroma cacao] Length = 561 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 110 VLEPWDVEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 + E + VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 32 LFELFVVEGGTRIGGRINTSEFGGDRIEMGATWIHG 67 >ref|XP_004307224.1| PREDICTED: probable polyamine oxidase 5 [Fragaria vesca subsp. vesca] Length = 551 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 116 EGVLEPWDVEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 E + E VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 30 EDLFELIVVEGGTRIGGRINTSEFGGDRIEMGATWIHG 67 >ref|XP_014508345.1| PREDICTED: probable polyamine oxidase 5 [Vigna radiata var. radiata] Length = 528 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >gb|KOM29612.1| hypothetical protein LR48_Vigan728s003500 [Vigna angularis] Length = 536 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >gb|KHN24608.1| Putative polyamine oxidase 5 [Glycine soja] Length = 578 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 38 VEGGTRIGGRINTSEFGGDRIEMGATWIHG 67 >gb|KHN17669.1| Putative polyamine oxidase 5 [Glycine soja] Length = 529 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >gb|KHN06611.1| Putative polyamine oxidase 5 [Glycine soja] gi|947070265|gb|KRH19156.1| hypothetical protein GLYMA_13G104100 [Glycine max] Length = 538 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_010047573.1| PREDICTED: probable polyamine oxidase 5 [Eucalyptus grandis] gi|629114845|gb|KCW79520.1| hypothetical protein EUGRSUZ_C00897 [Eucalyptus grandis] Length = 562 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGTRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_002514111.1| conserved hypothetical protein [Ricinus communis] gi|223546567|gb|EEF48065.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 40 VEGGTRIGGRINTSEFGGDRIEMGATWIHG 69 >ref|XP_006587008.1| PREDICTED: probable polyamine oxidase 5-like [Glycine max] gi|734411231|gb|KHN35843.1| Putative polyamine oxidase 5 [Glycine soja] gi|947088722|gb|KRH37387.1| hypothetical protein GLYMA_09G063000 [Glycine max] Length = 600 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGTRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_006346568.1| PREDICTED: probable polyamine oxidase 5-like [Solanum tuberosum] Length = 520 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_003550632.1| PREDICTED: probable polyamine oxidase 5-like [Glycine max] gi|947053260|gb|KRH02713.1| hypothetical protein GLYMA_17G055000 [Glycine max] Length = 530 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGNRIGGRINTSEFGGDRIEMGATWIHG 68 >ref|XP_003546459.1| PREDICTED: probable polyamine oxidase 5-like [Glycine max] gi|947063125|gb|KRH12386.1| hypothetical protein GLYMA_15G169600 [Glycine max] Length = 581 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 92 VEGGSRIGGRINTSEFGGDRIEMGATWIHG 3 VEGG+RIGGRINTSEFGGDRIEMGATWIHG Sbjct: 39 VEGGTRIGGRINTSEFGGDRIEMGATWIHG 68