BLASTX nr result
ID: Ziziphus21_contig00039125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039125 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100177.1| PREDICTED: glycine, alanine and asparagine-r... 61 3e-07 >ref|XP_011100177.1| PREDICTED: glycine, alanine and asparagine-rich protein-like [Sesamum indicum] Length = 110 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 4/59 (6%) Frame = +3 Query: 6 GLVFEGGGE---KKGILDGIVGMEGMFGSEVAGRGGKLSFGRLGM-VGSGGRVPGLGRD 170 G FEGGGE K+GI+ GIVG+EG+ G+E AG GG+ +FG GM VG+GG V G GRD Sbjct: 14 GKQFEGGGERNGKEGIVVGIVGIEGIVGNEKAGNGGRATFGIAGMEVGNGGNV-GFGRD 71