BLASTX nr result
ID: Ziziphus21_contig00039122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039122 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_009354905.1| PREDICTED: putative pentatricopeptide repeat... 69 1e-09 ref|XP_009354903.1| PREDICTED: putative pentatricopeptide repeat... 69 1e-09 ref|XP_006442356.1| hypothetical protein CICLE_v10024500mg [Citr... 68 2e-09 ref|XP_007050389.1| Pentatricopeptide repeat-containing protein,... 68 3e-09 ref|XP_008372326.1| PREDICTED: putative pentatricopeptide repeat... 67 4e-09 ref|XP_008235309.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_006477829.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 emb|CDP03708.1| unnamed protein product [Coffea canephora] 67 7e-09 ref|XP_012490661.1| PREDICTED: putative pentatricopeptide repeat... 66 9e-09 gb|KJB42224.1| hypothetical protein B456_007G143100 [Gossypium r... 66 9e-09 ref|XP_007201713.1| hypothetical protein PRUPE_ppa003905mg [Prun... 66 9e-09 ref|XP_010100079.1| hypothetical protein L484_005753 [Morus nota... 64 3e-08 ref|XP_002520999.1| pentatricopeptide repeat-containing protein,... 64 3e-08 ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat... 64 6e-08 ref|XP_009781797.1| PREDICTED: putative pentatricopeptide repeat... 63 7e-08 ref|XP_009781795.1| PREDICTED: putative pentatricopeptide repeat... 63 7e-08 ref|XP_010038027.1| PREDICTED: putative pentatricopeptide repeat... 62 2e-07 ref|XP_010038028.1| PREDICTED: putative pentatricopeptide repeat... 62 2e-07 gb|KCW49827.1| hypothetical protein EUGRSUZ_K03305 [Eucalyptus g... 62 2e-07 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/58 (63%), Positives = 44/58 (75%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKAGER*HE 111 E KVVELL M E+ PDAST+SIV++LLSKDEKY E+L+LLPTFPAQ R +E Sbjct: 568 EMQKVVELLQEMAEKDFSPDASTISIVVDLLSKDEKYREYLHLLPTFPAQGQTGRGYE 625 >ref|XP_009354905.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Pyrus x bretschneideri] Length = 633 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 +S KVVELL++M ER + PDASTVSIVI+LL KDEKY + L+LLPTFPA Sbjct: 578 DSAKVVELLHKMAERNLSPDASTVSIVIDLLLKDEKYRKCLDLLPTFPA 626 >ref|XP_009354903.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Pyrus x bretschneideri] gi|694328162|ref|XP_009354904.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Pyrus x bretschneideri] Length = 634 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 +S KVVELL++M ER + PDASTVSIVI+LL KDEKY + L+LLPTFPA Sbjct: 578 DSAKVVELLHKMAERNLSPDASTVSIVIDLLLKDEKYRKCLDLLPTFPA 626 >ref|XP_006442356.1| hypothetical protein CICLE_v10024500mg [Citrus clementina] gi|557544618|gb|ESR55596.1| hypothetical protein CICLE_v10024500mg [Citrus clementina] Length = 515 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/49 (61%), Positives = 42/49 (85%) Frame = -1 Query: 275 KVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKA 129 KVVELL++M ER + PDA S+V++LL+KDEKYC+FL+LLP+FP Q++ Sbjct: 459 KVVELLHKMKERNVMPDAYVCSVVVDLLAKDEKYCKFLDLLPSFPIQES 507 >ref|XP_007050389.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590716300|ref|XP_007050390.1| RTE1 isoform 1 [Theobroma cacao] gi|590716304|ref|XP_007050391.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508702650|gb|EOX94546.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508702651|gb|EOX94547.1| RTE1 isoform 1 [Theobroma cacao] gi|508702652|gb|EOX94548.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 621 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQK 132 E+ K+VELL +MVE+++ PDAST+S V++LLSKDE Y E L LLPTFP Q+ Sbjct: 569 ETQKMVELLQKMVEKKLSPDASTISAVVDLLSKDEAYHETLKLLPTFPVQE 619 >ref|XP_008372326.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Malus domestica] gi|657961464|ref|XP_008372327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Malus domestica] Length = 633 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFP 141 +S KVVE+L++M ER + PDA TVSIVI+LLSKDEKY + L+LLPTFP Sbjct: 578 DSAKVVEJLHKMAERNLSPDAITVSIVIDLLSKDEKYRKCLDLLPTFP 625 >ref|XP_008235309.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Prunus mume] Length = 631 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 +S KVVELL++MV R + PD+ T+S+VI+LLSKDEKY + L+LLPTFPA Sbjct: 576 DSAKVVELLHKMVTRNLSPDSCTISVVIDLLSKDEKYRKCLDLLPTFPA 624 >ref|XP_006477829.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Citrus sinensis] Length = 364 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/49 (61%), Positives = 42/49 (85%) Frame = -1 Query: 275 KVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKA 129 KVVELL++M ER + PDA S+V++LL+KDEKYC+FL+LLP+FP Q++ Sbjct: 308 KVVELLHKMKERNVKPDAYVCSVVVDLLAKDEKYCKFLDLLPSFPIQES 356 >emb|CDP03708.1| unnamed protein product [Coffea canephora] Length = 607 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQ 135 E+ +V+ELL R+ ER PDAST+S+VI+LLSKD+++ ++LNL+PTFP Q Sbjct: 557 EADRVIELLQRLAEREFLPDASTLSVVIDLLSKDDRHMKYLNLIPTFPIQ 606 >ref|XP_012490661.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Gossypium raimondii] Length = 621 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQ 135 ++ KVV+LL++MVE+++ PDASTV+ V++LLSKDE Y E L LLPTFP Q Sbjct: 568 DTQKVVKLLHKMVEKKLSPDASTVAAVVDLLSKDEAYLETLKLLPTFPVQ 617 >gb|KJB42224.1| hypothetical protein B456_007G143100 [Gossypium raimondii] Length = 366 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQ 135 ++ KVV+LL++MVE+++ PDASTV+ V++LLSKDE Y E L LLPTFP Q Sbjct: 313 DTQKVVKLLHKMVEKKLSPDASTVAAVVDLLSKDEAYLETLKLLPTFPVQ 362 >ref|XP_007201713.1| hypothetical protein PRUPE_ppa003905mg [Prunus persica] gi|462397113|gb|EMJ02912.1| hypothetical protein PRUPE_ppa003905mg [Prunus persica] Length = 541 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 +S KVVELL+ MV R + PD+ T+SIVI+LLSKDEKY + L+LLPTFPA Sbjct: 486 DSAKVVELLHMMVARNLSPDSCTISIVIDLLSKDEKYRKCLDLLPTFPA 534 >ref|XP_010100079.1| hypothetical protein L484_005753 [Morus notabilis] gi|587892744|gb|EXB81315.1| hypothetical protein L484_005753 [Morus notabilis] Length = 549 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -1 Query: 275 KVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQK 132 KVVELL++M +R + PDAST SIVI+L+SKD+KY E L+LLPTFP Q+ Sbjct: 489 KVVELLHQMAKRNVQPDASTFSIVIDLVSKDKKYRECLDLLPTFPMQE 536 >ref|XP_002520999.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539836|gb|EEF41416.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 628 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKA 129 E K+VELL++M R++ PDAST+ IV+++L KDE Y E LNLLPTFP Q+A Sbjct: 576 ERPKIVELLHKMAARKLSPDASTLLIVMDILLKDENYHECLNLLPTFPVQEA 627 >ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116958|ref|XP_009612408.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116960|ref|XP_009612409.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116962|ref|XP_009612410.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116964|ref|XP_009612411.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116966|ref|XP_009612412.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116968|ref|XP_009612413.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] Length = 599 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = -1 Query: 275 KVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKAGE 123 +VV LL +M E+ + PD ST+S+V+ LLSKD+KY E+LNL+PTFP ++GE Sbjct: 549 QVVNLLQKMAEKHLSPDLSTISLVVELLSKDDKYHEYLNLIPTFPT-RSGE 598 >ref|XP_009781797.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 547 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -1 Query: 275 KVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKA 129 +VV LL +M E+ + PD ST+S+V+ LLSKD+KY E+LNL+PTFP + + Sbjct: 487 QVVNLLQKMAEKHISPDLSTISLVVELLSKDDKYHEYLNLIPTFPTRSS 535 >ref|XP_009781795.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Nicotiana sylvestris] gi|698461540|ref|XP_009781796.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 605 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -1 Query: 275 KVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPAQKA 129 +VV LL +M E+ + PD ST+S+V+ LLSKD+KY E+LNL+PTFP + + Sbjct: 545 QVVNLLQKMAEKHISPDLSTISLVVELLSKDDKYHEYLNLIPTFPTRSS 593 >ref|XP_010038027.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] gi|629083381|gb|KCW49826.1| hypothetical protein EUGRSUZ_K03304 [Eucalyptus grandis] Length = 547 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 E+LKV+ELL +M + M PD++T SIV +LLSKD+ Y E+L LLP FP+ Sbjct: 499 EALKVIELLKKMAGKNMIPDSTTASIVFDLLSKDKNYHEYLTLLPAFPS 547 >ref|XP_010038028.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] gi|702499674|ref|XP_010038029.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] Length = 644 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 E+LKV+ELL +M + + PDA+T SIV +LLSKD+ Y E+L LLP FP+ Sbjct: 596 EALKVIELLKKMAGKNILPDATTASIVFDLLSKDKNYHEYLTLLPAFPS 644 >gb|KCW49827.1| hypothetical protein EUGRSUZ_K03305 [Eucalyptus grandis] Length = 624 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = -1 Query: 284 ESLKVVELLNRMVERRMFPDASTVSIVINLLSKDEKYCEFLNLLPTFPA 138 E+LKV+ELL +M + + PDA+T SIV +LLSKD+ Y E+L LLP FP+ Sbjct: 576 EALKVIELLKKMAGKNILPDATTASIVFDLLSKDKNYHEYLTLLPAFPS 624