BLASTX nr result
ID: Ziziphus21_contig00039105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039105 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010108113.1| hypothetical protein L484_023201 [Morus nota... 154 3e-35 ref|XP_012831578.1| PREDICTED: pentatricopeptide repeat-containi... 150 3e-34 ref|XP_007040009.1| Tetratricopeptide repeat-like superfamily pr... 150 3e-34 ref|XP_008238657.1| PREDICTED: pentatricopeptide repeat-containi... 150 5e-34 ref|XP_007210066.1| hypothetical protein PRUPE_ppa021101mg [Prun... 150 5e-34 ref|XP_004147606.1| PREDICTED: pentatricopeptide repeat-containi... 149 6e-34 emb|CAN64316.1| hypothetical protein VITISV_027915 [Vitis vinifera] 149 8e-34 ref|XP_008437157.1| PREDICTED: pentatricopeptide repeat-containi... 149 1e-33 gb|KNA14719.1| hypothetical protein SOVF_105010 [Spinacia oleracea] 148 2e-33 ref|XP_010053395.1| PREDICTED: pentatricopeptide repeat-containi... 148 2e-33 gb|KCW77674.1| hypothetical protein EUGRSUZ_D01976 [Eucalyptus g... 148 2e-33 gb|KHN03382.1| Pentatricopeptide repeat-containing protein [Glyc... 147 2e-33 ref|XP_009373354.1| PREDICTED: pentatricopeptide repeat-containi... 147 2e-33 emb|CBI22140.3| unnamed protein product [Vitis vinifera] 147 2e-33 ref|XP_002303536.1| pentatricopeptide repeat-containing family p... 147 2e-33 ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containi... 147 2e-33 ref|XP_003550529.1| PREDICTED: pentatricopeptide repeat-containi... 147 2e-33 ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containi... 147 3e-33 ref|NP_194007.2| pentatricopeptide repeat-containing protein [Ar... 147 3e-33 ref|XP_002869806.1| pentatricopeptide repeat-containing protein ... 147 3e-33 >ref|XP_010108113.1| hypothetical protein L484_023201 [Morus notabilis] gi|587930736|gb|EXC17845.1| hypothetical protein L484_023201 [Morus notabilis] Length = 577 Score = 154 bits (388), Expect = 3e-35 Identities = 70/88 (79%), Positives = 80/88 (90%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF+SMKD G+ PS DHY MVDLLGR+GRLEEA+ELIKSMP+QPHAGV Sbjct: 443 YNHAGLVEEGYKCFNSMKDQGLLPSVDHYGTMVDLLGRAGRLEEAHELIKSMPMQPHAGV 502 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACR+HNNV LGEIAA NCF L+ Sbjct: 503 WGALLLACRVHNNVDLGEIAARNCFDLQ 530 >ref|XP_012831578.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Erythranthe guttatus] gi|604343199|gb|EYU42170.1| hypothetical protein MIMGU_mgv1a003558mg [Erythranthe guttata] Length = 578 Score = 150 bits (380), Expect = 3e-34 Identities = 68/88 (77%), Positives = 80/88 (90%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 YSHAGLV++GY+CF SM+ HG+ PS DHYSI+VDLLG++GRLEEAYELIK MP+QPHAGV Sbjct: 442 YSHAGLVKEGYRCFKSMETHGLVPSQDHYSIVVDLLGKAGRLEEAYELIKRMPMQPHAGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLAC LHNNV+L E+AA NCF+LE Sbjct: 502 WGALLLACSLHNNVELAEVAAKNCFELE 529 >ref|XP_007040009.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508777254|gb|EOY24510.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 576 Score = 150 bits (380), Expect = 3e-34 Identities = 67/88 (76%), Positives = 80/88 (90%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF SMKD+G+ PS DHY+IMVDLLGR+GRLE+AYELIKSMP++PH GV Sbjct: 442 YNHAGLVEEGYRCFSSMKDNGLVPSTDHYAIMVDLLGRAGRLEDAYELIKSMPMKPHTGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WG LLLAC LHNNV+ GEIAA +CF+LE Sbjct: 502 WGGLLLACSLHNNVEFGEIAAQHCFELE 529 >ref|XP_008238657.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Prunus mume] Length = 578 Score = 150 bits (378), Expect = 5e-34 Identities = 68/88 (77%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF+SM DHGV PS DHY IMVDLLGR+G+ ++A ELI+SMP+QP AGV Sbjct: 444 YNHAGLVEEGYRCFNSMNDHGVVPSGDHYGIMVDLLGRAGQFDKALELIRSMPMQPQAGV 503 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLAC LHNNV+LGEIAA NCFKLE Sbjct: 504 WGALLLACSLHNNVELGEIAARNCFKLE 531 >ref|XP_007210066.1| hypothetical protein PRUPE_ppa021101mg [Prunus persica] gi|462405801|gb|EMJ11265.1| hypothetical protein PRUPE_ppa021101mg [Prunus persica] Length = 578 Score = 150 bits (378), Expect = 5e-34 Identities = 68/88 (77%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF+SM DHGV PS DHY IMVDLLGR+G+ ++A ELI+SMP+QP AGV Sbjct: 444 YNHAGLVEEGYRCFNSMNDHGVVPSGDHYGIMVDLLGRAGQFDKALELIRSMPMQPQAGV 503 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLAC LHNNV+LGEIAA NCFKLE Sbjct: 504 WGALLLACSLHNNVELGEIAARNCFKLE 531 >ref|XP_004147606.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Cucumis sativus] gi|700195014|gb|KGN50191.1| hypothetical protein Csa_5G157980 [Cucumis sativus] Length = 580 Score = 149 bits (377), Expect = 6e-34 Identities = 69/87 (79%), Positives = 79/87 (90%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLV++GY CF SMKDHG++P ADHY IMVDLLGR+GRLEEAYELI SMP+QP+AGV Sbjct: 444 YNHAGLVDEGYLCFSSMKDHGLAPLADHYGIMVDLLGRAGRLEEAYELIHSMPVQPNAGV 503 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKL 4 WGALL AC+LHNNV+LGEIAA NC KL Sbjct: 504 WGALLHACKLHNNVELGEIAARNCSKL 530 >emb|CAN64316.1| hypothetical protein VITISV_027915 [Vitis vinifera] Length = 841 Score = 149 bits (376), Expect = 8e-34 Identities = 68/88 (77%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF SMK + + PS DHY IMVDLLGR+GRL+EA ELIKSMP+QPHAGV Sbjct: 442 YNHAGLVEEGYRCFTSMKKYNLVPSVDHYGIMVDLLGRAGRLQEALELIKSMPMQPHAGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+ GEIAA +CF+LE Sbjct: 502 WGALLLACRLHNNVEFGEIAAQHCFELE 529 >ref|XP_008437157.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Cucumis melo] Length = 580 Score = 149 bits (375), Expect = 1e-33 Identities = 68/86 (79%), Positives = 79/86 (91%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLV++GY CF SMKDHG++P ADHY IMVDLLGR+GRLEEAYELI+SMP+QP+AGV Sbjct: 444 YNHAGLVDEGYFCFSSMKDHGLAPLADHYGIMVDLLGRAGRLEEAYELIRSMPVQPNAGV 503 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFK 7 WGALL AC+LHNNV+LGEIAA NC K Sbjct: 504 WGALLHACKLHNNVELGEIAARNCSK 529 >gb|KNA14719.1| hypothetical protein SOVF_105010 [Spinacia oleracea] Length = 573 Score = 148 bits (373), Expect = 2e-33 Identities = 68/88 (77%), Positives = 78/88 (88%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF+ M GV PSADHY IMVDLLGR+GR+EEAYELIKSMP+ PH+GV Sbjct: 442 YNHAGLVEEGYRCFNLMSKFGVMPSADHYGIMVDLLGRAGRVEEAYELIKSMPILPHSGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+L EIAA +CF LE Sbjct: 502 WGALLLACRLHNNVELAEIAAQHCFNLE 529 >ref|XP_010053395.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Eucalyptus grandis] Length = 580 Score = 148 bits (373), Expect = 2e-33 Identities = 66/88 (75%), Positives = 81/88 (92%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 YSH GLVE+GY+ F+SMK++G+ PSADHY +MVDLLGR+G LE+AY LIK+MP+QPHAGV Sbjct: 446 YSHTGLVEEGYRSFNSMKNYGLVPSADHYGMMVDLLGRAGHLEDAYNLIKTMPMQPHAGV 505 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV++GEIAA +CFKL+ Sbjct: 506 WGALLLACRLHNNVEIGEIAARHCFKLD 533 >gb|KCW77674.1| hypothetical protein EUGRSUZ_D01976 [Eucalyptus grandis] Length = 576 Score = 148 bits (373), Expect = 2e-33 Identities = 66/88 (75%), Positives = 81/88 (92%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 YSH GLVE+GY+ F+SMK++G+ PSADHY +MVDLLGR+G LE+AY LIK+MP+QPHAGV Sbjct: 442 YSHTGLVEEGYRSFNSMKNYGLVPSADHYGMMVDLLGRAGHLEDAYNLIKTMPMQPHAGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV++GEIAA +CFKL+ Sbjct: 502 WGALLLACRLHNNVEIGEIAARHCFKLD 529 >gb|KHN03382.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 535 Score = 147 bits (372), Expect = 2e-33 Identities = 67/88 (76%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVEKGYQCF+SMKD+G+ PS DHY IMVDL GR+G L+EAY+LI +MP+QP+AGV Sbjct: 401 YNHAGLVEKGYQCFNSMKDYGLVPSIDHYGIMVDLFGRAGYLDEAYKLILNMPMQPNAGV 460 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+LGEIA +C KLE Sbjct: 461 WGALLLACRLHNNVELGEIAVQHCIKLE 488 >ref|XP_009373354.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Pyrus x bretschneideri] Length = 578 Score = 147 bits (372), Expect = 2e-33 Identities = 66/88 (75%), Positives = 80/88 (90%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+G++CF+SMK+HG+ PS DHY IMVDLLGR+G+L++A ELI+SMP+QP AGV Sbjct: 444 YNHAGLVEEGHRCFNSMKEHGLEPSGDHYGIMVDLLGRAGQLDKAVELIRSMPMQPQAGV 503 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLAC LHNNV+LGE AA NCFKLE Sbjct: 504 WGALLLACSLHNNVELGETAARNCFKLE 531 >emb|CBI22140.3| unnamed protein product [Vitis vinifera] Length = 428 Score = 147 bits (372), Expect = 2e-33 Identities = 67/88 (76%), Positives = 78/88 (88%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF SMK + + PS DHY IMVDL GR+GRL+EA ELIKSMP+QPHAGV Sbjct: 294 YNHAGLVEEGYRCFTSMKKYNLVPSVDHYGIMVDLFGRAGRLQEALELIKSMPMQPHAGV 353 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+ GEIAA +CF+LE Sbjct: 354 WGALLLACRLHNNVEFGEIAAQHCFELE 381 >ref|XP_002303536.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222840968|gb|EEE78515.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 596 Score = 147 bits (372), Expect = 2e-33 Identities = 66/87 (75%), Positives = 80/87 (91%) Frame = -3 Query: 261 SHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGVW 82 +HAGLV++GY+ F SMKDHG+ PS DHY+IMVDLLGR+GRL++AYELIKSMP+QPH+GVW Sbjct: 463 NHAGLVKEGYRFFSSMKDHGLVPSTDHYAIMVDLLGRAGRLQDAYELIKSMPMQPHSGVW 522 Query: 81 GALLLACRLHNNVQLGEIAAWNCFKLE 1 GALLLAC +HNNV+LGEIAA +CF LE Sbjct: 523 GALLLACNVHNNVELGEIAAQHCFNLE 549 >ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Vitis vinifera] Length = 580 Score = 147 bits (372), Expect = 2e-33 Identities = 67/88 (76%), Positives = 78/88 (88%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY+CF SMK + + PS DHY IMVDL GR+GRL+EA ELIKSMP+QPHAGV Sbjct: 446 YNHAGLVEEGYRCFTSMKKYNLVPSVDHYGIMVDLFGRAGRLQEALELIKSMPMQPHAGV 505 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+ GEIAA +CF+LE Sbjct: 506 WGALLLACRLHNNVEFGEIAAQHCFELE 533 >ref|XP_003550529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Glycine max] gi|947052764|gb|KRH02217.1| hypothetical protein GLYMA_17G024100 [Glycine max] Length = 576 Score = 147 bits (372), Expect = 2e-33 Identities = 67/88 (76%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVEKGYQCF+SMKD+G+ PS DHY IMVDL GR+G L+EAY+LI +MP+QP+AGV Sbjct: 442 YNHAGLVEKGYQCFNSMKDYGLVPSIDHYGIMVDLFGRAGYLDEAYKLILNMPMQPNAGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+LGEIA +C KLE Sbjct: 502 WGALLLACRLHNNVELGEIAVQHCIKLE 529 >ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Vitis vinifera] gi|296083555|emb|CBI23551.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 147 bits (371), Expect = 3e-33 Identities = 67/88 (76%), Positives = 77/88 (87%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 Y+HAGLVE+GY CF SMK + + PS DHY IMVDL GR+GRL+EA ELIKSMP+QPHAGV Sbjct: 446 YNHAGLVEEGYHCFTSMKKYNLVPSVDHYGIMVDLFGRAGRLQEALELIKSMPMQPHAGV 505 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLACRLHNNV+ GEIAA +CF+LE Sbjct: 506 WGALLLACRLHNNVEFGEIAAQHCFELE 533 >ref|NP_194007.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635615|sp|P0C8Q5.1|PP336_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g22760 gi|332659255|gb|AEE84655.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 578 Score = 147 bits (371), Expect = 3e-33 Identities = 67/88 (76%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 YSH+GLV++GY+CF+SMKDH + PSADHY IMVD+LGR+GRLEEAYELIKSMP+QP+AGV Sbjct: 442 YSHSGLVQEGYKCFNSMKDHNLEPSADHYGIMVDMLGRAGRLEEAYELIKSMPMQPNAGV 501 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLA LHNNV+ GEIA +C KLE Sbjct: 502 WGALLLASGLHNNVEFGEIACSHCVKLE 529 >ref|XP_002869806.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315642|gb|EFH46065.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 852 Score = 147 bits (371), Expect = 3e-33 Identities = 67/88 (76%), Positives = 79/88 (89%) Frame = -3 Query: 264 YSHAGLVEKGYQCFDSMKDHGVSPSADHYSIMVDLLGRSGRLEEAYELIKSMPLQPHAGV 85 YSH+GLV++GY+CF+SMKDH + PSADHY IMVD+LGR+GRLEEAYELIKSMP+QP+AGV Sbjct: 703 YSHSGLVQEGYKCFNSMKDHNLEPSADHYGIMVDMLGRAGRLEEAYELIKSMPMQPNAGV 762 Query: 84 WGALLLACRLHNNVQLGEIAAWNCFKLE 1 WGALLLA LHNNV+ GEIA +C KLE Sbjct: 763 WGALLLASGLHNNVEFGEIACSHCVKLE 790