BLASTX nr result
ID: Ziziphus21_contig00039059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039059 (248 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 84 5e-15 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 76 9e-12 gb|KDP38711.1| hypothetical protein JCGZ_04064 [Jatropha curcas] 72 2e-10 gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium r... 69 1e-09 ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Popu... 69 1e-09 ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Popu... 66 1e-08 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_009110774.1| PREDICTED: uncharacterized protein LOC103836... 61 3e-07 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 49 2e-06 ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phas... 59 2e-06 ref|XP_007133040.1| hypothetical protein PHAVU_011G146300g, part... 58 3e-06 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 84.0 bits (206), Expect(2) = 5e-15 Identities = 44/73 (60%), Positives = 50/73 (68%) Frame = -3 Query: 219 GALRVLEL*RRPIRSDLD*LSTGPPVPSRESNLVVWAKARTTWLIAWRAPREAGFTEQRS 40 G ++V+ I L L +GPPVPSRE VV AKAR T ++ WRAPREAGFTEQR Sbjct: 50 GGIKVVGRGLESIGPGLQRLLSGPPVPSRELIHVVRAKARATCVLKWRAPREAGFTEQRK 109 Query: 39 PPTYGSGRITGRC 1 PP GSGRITGRC Sbjct: 110 PPAPGSGRITGRC 122 Score = 23.5 bits (49), Expect(2) = 5e-15 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 247 SVTRACDLCGGIK 209 SV RACD GGIK Sbjct: 41 SVARACDPSGGIK 53 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/51 (70%), Positives = 37/51 (72%) Frame = -2 Query: 154 WPARSKPRVEPCGLGEGPDYMAHSVEGTA*GWLHRAAITSYLRQWKDNGSV 2 W ARSK RV+PCGLGEGP M EGTA GW HRAAITS QWKDNG V Sbjct: 3 WLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPV 53 >gb|KDP38711.1| hypothetical protein JCGZ_04064 [Jatropha curcas] Length = 76 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/65 (58%), Positives = 41/65 (63%) Frame = -2 Query: 196 LTPTHSIGSGLAEYWPARSKPRVEPCGLGEGPDYMAHSVEGTA*GWLHRAAITSYLRQWK 17 + H + LA W ARSKPRVE GEG + VEGTA GWLHRAAITS QWK Sbjct: 1 MASAHLVDLHLAISWLARSKPRVESIDPGEGLVRLTPKVEGTALGWLHRAAITSLSWQWK 60 Query: 16 DNGSV 2 DNGSV Sbjct: 61 DNGSV 65 >gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium raimondii] Length = 79 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = -3 Query: 162 LSTGPPVPSRESNLVVWAKARTTWLIAWRAPREAGFTEQRSPPTYGSGRITGRC 1 LS+G VPS+E + V AKA WL+ W+APREAGFTEQR P GSGRITG C Sbjct: 8 LSSGLSVPSQELSQVSCAKAWVLWLLEWKAPREAGFTEQRKLPPLGSGRITGCC 61 >ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] gi|550318586|gb|ERP49937.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] Length = 83 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/61 (55%), Positives = 41/61 (67%) Frame = -3 Query: 183 IRSDLD*LSTGPPVPSRESNLVVWAKARTTWLIAWRAPREAGFTEQRSPPTYGSGRITGR 4 +RS L + PPVPS+E + + K +WL+ RA REAG TEQRSPP GSGRITGR Sbjct: 3 VRSGSGCLLSDPPVPSQELSQGILVKTLVSWLLEGRAQREAGLTEQRSPPAPGSGRITGR 62 Query: 3 C 1 C Sbjct: 63 C 63 >ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] gi|550305511|gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -3 Query: 183 IRSDLD*LSTGPPVPSRESNLVVWAKARTTWLIAWRAPREAGFTEQRSPPTYGSGRITGR 4 +RS +GPPVPS+E + + K +WL+ RA REAG TEQRS P GSGRITGR Sbjct: 3 VRSGSGCFLSGPPVPSQELSQGILVKTWVSWLLEGRAQREAGLTEQRSLPAPGSGRITGR 62 Query: 3 C 1 C Sbjct: 63 C 63 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -3 Query: 159 STGPPVPSRESNLVVWAKARTTWLIAWRAPREAGFTEQRSPPTYGSGRITGRC 1 + G P PS E + VV AK TT L+ WR REAGFTEQRSPP SG ITG C Sbjct: 8 TAGLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSC 60 >ref|XP_009110774.1| PREDICTED: uncharacterized protein LOC103836284 [Brassica rapa] Length = 98 Score = 61.2 bits (147), Expect = 3e-07 Identities = 39/82 (47%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = -2 Query: 247 SVTRACDLCGGIKGA*T-LTPTHSIGSGLAEYWPARSKPRVEPCGLGEGPDYMAHSVEGT 71 SVTRACD CG K L P +GS +A +W A+SKPRV G Sbjct: 12 SVTRACDPCGDNKLVEHWLGP--QVGSVMALFWAAQSKPRVN---------------RGN 54 Query: 70 A*GWLHRAAITSYLRQWKDNGS 5 A GW HRAAITS RQW D+GS Sbjct: 55 ALGWFHRAAITSLFRQWTDHGS 76 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +2 Query: 2 HRPVILPLP*VGGDRCSVKPASRGALHAMSHVVRAFAQ 115 H+ VILPLP GG RCSVKPASR AL + + V AFAQ Sbjct: 17 HQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQ 54 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 97 SPGLRPNHKVRLSAWNGRASTQLIQIRSNG 186 +P H +LSAWNGRA Q Q R G Sbjct: 49 TPAFAQGHIAQLSAWNGRARAQPHQGRPTG 78 >ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] gi|561006039|gb|ESW05033.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] Length = 93 Score = 58.5 bits (140), Expect = 2e-06 Identities = 36/77 (46%), Positives = 43/77 (55%) Frame = +2 Query: 5 RPVILPLP*VGGDRCSVKPASRGALHAMSHVVRAFAQTTRFDSRLGTGGPVLXXXXXXXX 184 +PVILPL +GG RCSVKPASR ALH+ S AF + R +S+LG G P Sbjct: 3 QPVILPLLGMGGGRCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRPTNCKHSPTQQ 62 Query: 185 XXXXXXXTLNAPT*VTS 235 + NAPT VTS Sbjct: 63 ASMLFHHS-NAPTWVTS 78 >ref|XP_007133040.1| hypothetical protein PHAVU_011G146300g, partial [Phaseolus vulgaris] gi|561006040|gb|ESW05034.1| hypothetical protein PHAVU_011G146300g, partial [Phaseolus vulgaris] Length = 57 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +2 Query: 5 RPVILPLP*VGGDRCSVKPASRGALHAMSHVVRAFAQTTRFDSRLGTGGP 154 +PVILPL +GG RCSVKPASR ALH+ S AF + R +S+LG G P Sbjct: 3 QPVILPLLGMGGGRCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRP 52