BLASTX nr result
ID: Ziziphus21_contig00039034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039034 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14717.1| unnamed protein product [Coffea canephora] 57 5e-06 >emb|CDP14717.1| unnamed protein product [Coffea canephora] Length = 971 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/61 (39%), Positives = 43/61 (70%) Frame = -2 Query: 192 KPKSEVQLWLKLVEKVENEVSGMQNDIGEKGRYMKGCYPNCYSRYKLGKFIALKMKEVNE 13 +PK+EV+LWL+ V+++++ V+ ++ D + R + GC+PN Y R KLG + ++ +VNE Sbjct: 25 EPKAEVKLWLENVDQIKDSVNKVKEDSADDRRCLIGCFPNYYFRMKLGNMVEEQIHKVNE 84 Query: 12 L 10 L Sbjct: 85 L 85