BLASTX nr result
ID: Ziziphus21_contig00039019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039019 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008238692.1| PREDICTED: pentatricopeptide repeat-containi... 134 4e-29 ref|XP_010089197.1| hypothetical protein L484_002563 [Morus nota... 130 3e-28 ref|XP_010099794.1| hypothetical protein L484_004369 [Morus nota... 129 7e-28 ref|XP_009379032.1| PREDICTED: pentatricopeptide repeat-containi... 124 3e-26 ref|XP_011461275.1| PREDICTED: pentatricopeptide repeat-containi... 124 4e-26 ref|XP_008378727.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_004301454.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_006470533.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_006446304.1| hypothetical protein CICLE_v100144562mg, par... 114 3e-23 gb|KDO54786.1| hypothetical protein CISIN_1g004976mg [Citrus sin... 113 5e-23 ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-23 gb|KNA25115.1| hypothetical protein SOVF_009240 [Spinacia oleracea] 111 2e-22 ref|XP_010673763.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_011009113.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_011014424.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_012065874.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_002313262.2| hypothetical protein POPTR_0009s07380g [Popu... 100 7e-19 ref|XP_004244115.1| PREDICTED: pentatricopeptide repeat-containi... 100 7e-19 ref|XP_004492420.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_008219082.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 >ref|XP_008238692.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Prunus mume] Length = 711 Score = 134 bits (336), Expect = 4e-29 Identities = 62/99 (62%), Positives = 80/99 (80%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS CN L+ LT+SKNYELAFS+Y KMTHV IFP+F+S SC++A FVN N + A GV Sbjct: 71 PSGGACNLLVHTLTRSKNYELAFSVYSKMTHVGIFPSFISLSCLVACFVNTNHAKFAPGV 130 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 +G VLKRGF++N +V+NL+LK LC N+EVE+AMEL+S+M Sbjct: 131 LGLVLKRGFQLNVYVVNLMLKGLCSNDEVEKAMELFSVM 169 >ref|XP_010089197.1| hypothetical protein L484_002563 [Morus notabilis] gi|587847041|gb|EXB37463.1| hypothetical protein L484_002563 [Morus notabilis] Length = 750 Score = 130 bits (328), Expect = 3e-28 Identities = 59/100 (59%), Positives = 78/100 (78%) Frame = -2 Query: 301 FPSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALG 122 F S S CNFL+ LT+S+NY+L+FS+Y+KMTH+ IFPNF+S SC+IA FV+ KP+ ALG Sbjct: 60 FVSASTCNFLVHALTRSRNYDLSFSVYEKMTHLRIFPNFISLSCLIACFVDARKPKFALG 119 Query: 121 VVGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 V+G VLKRG++ NA V NL+LK C+N EVE A E + +M Sbjct: 120 VLGLVLKRGYKANALVRNLVLKGFCRNGEVEMAREFFDVM 159 >ref|XP_010099794.1| hypothetical protein L484_004369 [Morus notabilis] gi|587891857|gb|EXB80462.1| hypothetical protein L484_004369 [Morus notabilis] Length = 718 Score = 129 bits (325), Expect = 7e-28 Identities = 59/100 (59%), Positives = 77/100 (77%) Frame = -2 Query: 301 FPSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALG 122 F S S CNFL+ LT+S+NY+LAFS+Y+KMTH+ IFPNF+S SC+IA FV+ KP+ A G Sbjct: 60 FVSASTCNFLVHALTRSRNYDLAFSVYEKMTHLRIFPNFISLSCLIACFVDARKPKFARG 119 Query: 121 VVGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 V+G VLKRG++ NA V NL+LK C+N EVE A E + +M Sbjct: 120 VLGLVLKRGYKANALVRNLVLKGFCRNGEVEMAREFFDVM 159 >ref|XP_009379032.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Pyrus x bretschneideri] gi|694316198|ref|XP_009379037.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Pyrus x bretschneideri] Length = 733 Score = 124 bits (311), Expect = 3e-26 Identities = 57/98 (58%), Positives = 79/98 (80%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS + CN L+ LTKSKNYELAFS+Y KMT+V + P+F+S SC++A FVN + P+ A GV Sbjct: 71 PSGAACNLLVHTLTKSKNYELAFSVYSKMTNVGLRPSFISLSCLVACFVNSHHPKFAPGV 130 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSI 5 +G +LKRGF++NAFV+NL LK LC N+EV++A+EL+ + Sbjct: 131 LGLLLKRGFQLNAFVLNLTLKGLCANDEVDKAIELFRV 168 >ref|XP_011461275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Fragaria vesca subsp. vesca] gi|764560966|ref|XP_011461276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Fragaria vesca subsp. vesca] Length = 714 Score = 124 bits (310), Expect = 4e-26 Identities = 56/98 (57%), Positives = 76/98 (77%) Frame = -2 Query: 295 SPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGVV 116 S S CNFL+ LT+SKNYEL+FS+Y KMT V I P+F+S SC++ FVN KP+ A G+ Sbjct: 59 SASACNFLVDTLTRSKNYELSFSVYHKMTKVGIIPSFISLSCLVLCFVNMRKPEFATGIF 118 Query: 115 GSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 G +LKRGF++N +VMNL LK C N+EV++A+EL+S+M Sbjct: 119 GLLLKRGFQLNEYVMNLALKGFCSNDEVDKAIELFSVM 156 >ref|XP_008378727.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] gi|657973828|ref|XP_008378728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] gi|657973830|ref|XP_008378729.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] Length = 733 Score = 121 bits (304), Expect = 2e-25 Identities = 55/98 (56%), Positives = 78/98 (79%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS + CN L+ LTK KNYELAFS+Y KMT+V + P+F+S SC++A FVN + P+ A GV Sbjct: 71 PSGAACNLLVHTLTKXKNYELAFSVYSKMTNVGLRPSFISLSCLVACFVNSHHPEFAPGV 130 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSI 5 +G +L+RGF++NAFV+NL LK LC N+EV++A+EL+ + Sbjct: 131 LGLLLRRGFQLNAFVLNLTLKGLCANDEVDKAIELFRV 168 >ref|XP_004301454.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Fragaria vesca subsp. vesca] Length = 514 Score = 117 bits (292), Expect = 4e-24 Identities = 55/93 (59%), Positives = 72/93 (77%) Frame = -2 Query: 280 NFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGVVGSVLK 101 NFL+ L++SKNYELAFS+Y MT V IF +FVS SC+++YFV+ KP+LA GV G VLK Sbjct: 71 NFLVDALSRSKNYELAFSVYTMMTKVGIFTSFVSLSCLVSYFVSTRKPELARGVFGLVLK 130 Query: 100 RGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 RGF++N VMNL LK C N EV++A+EL+ +M Sbjct: 131 RGFQLNECVMNLALKGFCSNGEVDKAIELFDVM 163 >ref|XP_006470533.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Citrus sinensis] gi|568832635|ref|XP_006470534.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X2 [Citrus sinensis] Length = 721 Score = 114 bits (286), Expect = 2e-23 Identities = 55/96 (57%), Positives = 69/96 (71%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS S CN L+ L +SKNYE AFS+Y KMT VHIFP+F+S S +I FV KP+ ALGV Sbjct: 65 PSGSVCNSLMEALVRSKNYEYAFSVYSKMTRVHIFPSFLSLSGLIEVFVQTQKPKFALGV 124 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELY 11 +G +LKRGF VN + NLILK C+ EV +A+EL+ Sbjct: 125 IGLILKRGFVVNIYAFNLILKGFCRKGEVNKAIELF 160 >ref|XP_006446304.1| hypothetical protein CICLE_v100144562mg, partial [Citrus clementina] gi|557548915|gb|ESR59544.1| hypothetical protein CICLE_v100144562mg, partial [Citrus clementina] Length = 503 Score = 114 bits (285), Expect = 3e-23 Identities = 55/96 (57%), Positives = 70/96 (72%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS S CN L+ L +SKNYE AFS+Y KMT VHIFP+F+S S +I FV KP+ ALGV Sbjct: 65 PSGSVCNSLMQALVRSKNYEYAFSVYSKMTCVHIFPSFLSLSGLIEVFVQTQKPKFALGV 124 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELY 11 +G +LKRGF VN + NLILK+ C+ EV +A+EL+ Sbjct: 125 IGLILKRGFFVNIYAFNLILKAFCRKGEVNKAIELF 160 >gb|KDO54786.1| hypothetical protein CISIN_1g004976mg [Citrus sinensis] Length = 721 Score = 113 bits (283), Expect = 5e-23 Identities = 55/96 (57%), Positives = 69/96 (71%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS S CN L+ L +SKNYE AFS+Y KMT VHIFP+F+S S +I FV KP+ ALGV Sbjct: 65 PSGSVCNSLMEALVRSKNYEYAFSVYSKMTCVHIFPSFLSLSGLIEVFVQTQKPKFALGV 124 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELY 11 +G +LKRGF VN + NLILK C+ EV +A+EL+ Sbjct: 125 IGLILKRGFVVNIYAFNLILKGFCRKGEVNKAIELF 160 >ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vitis vinifera] Length = 728 Score = 113 bits (283), Expect = 5e-23 Identities = 54/95 (56%), Positives = 69/95 (72%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS + CNFL+ L +S+NY LAFS+Y++MTHV + P+F S S +I F + KPQL GV Sbjct: 72 PSWATCNFLVDALARSRNYGLAFSVYRRMTHVDVLPSFGSLSALIECFADAQKPQLGFGV 131 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMEL 14 VG VLKRGF VN F+MN++LK LC+N V EAM L Sbjct: 132 VGLVLKRGFTVNVFIMNIVLKGLCRNGGVFEAMGL 166 >gb|KNA25115.1| hypothetical protein SOVF_009240 [Spinacia oleracea] Length = 732 Score = 111 bits (277), Expect = 2e-22 Identities = 52/99 (52%), Positives = 69/99 (69%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PSP CNFL+ EL ++ +ELAFS+Y KMTHV I P F S + ++ Y V +P ALGV Sbjct: 75 PSPKTCNFLVNELREAGKHELAFSVYNKMTHVGIKPLFYSLAALLEYLVKSPEPSYALGV 134 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 VG + K GF VN ++MNL+LK LCQN E+++AME+ M Sbjct: 135 VGLIWKSGFEVNVYLMNLVLKGLCQNGEIDKAMEVLQEM 173 >ref|XP_010673763.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Beta vulgaris subsp. vulgaris] gi|870863442|gb|KMT14606.1| hypothetical protein BVRB_4g073760 [Beta vulgaris subsp. vulgaris] Length = 735 Score = 108 bits (270), Expect = 2e-21 Identities = 49/95 (51%), Positives = 68/95 (71%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS CNFL+ +L S +ELAF +YKKMTHV I P F S + ++ YFVN KP ALGV Sbjct: 75 PSSQTCNFLVNKLRMSGKHELAFCVYKKMTHVGIKPLFYSLAVLVEYFVNSPKPSYALGV 134 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMEL 14 VG + K G+ VN ++MNL+LK LC+N E+++A+++ Sbjct: 135 VGLIWKHGYEVNVYLMNLVLKGLCRNGEIDQALQV 169 >ref|XP_011009113.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Populus euphratica] Length = 720 Score = 105 bits (262), Expect = 1e-20 Identities = 53/98 (54%), Positives = 71/98 (72%) Frame = -2 Query: 295 SPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGVV 116 S S CN L+ L KSK++ELAFS+Y +MTHV I P+F+S S +I FV KPQLALGV+ Sbjct: 65 SQSACNSLMESLVKSKHHELAFSVYSRMTHVGILPSFISLSGLIDSFVFAKKPQLALGVL 124 Query: 115 GSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 G + KRGF V + +N+ILK LC+N EV A++L++ M Sbjct: 125 GLIFKRGFIVGVYNINVILKGLCRNKEVYGALDLFNRM 162 >ref|XP_011014424.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Populus euphratica] Length = 720 Score = 103 bits (258), Expect = 4e-20 Identities = 52/98 (53%), Positives = 70/98 (71%) Frame = -2 Query: 295 SPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGVV 116 S S CN L+ L KSK++ELAFS+Y +MTHV + P+F+S S +I FV KPQLALGV Sbjct: 65 SQSACNSLMESLVKSKHHELAFSVYSRMTHVGVLPSFISLSGLIDSFVFAKKPQLALGVS 124 Query: 115 GSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMELYSIM 2 G + KRGF V + +N+ILK LC+N EV A++L++ M Sbjct: 125 GLIFKRGFIVGVYNINVILKGLCRNKEVYGALDLFNRM 162 >ref|XP_012065874.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Jatropha curcas] gi|643737000|gb|KDP43206.1| hypothetical protein JCGZ_22758 [Jatropha curcas] Length = 682 Score = 101 bits (252), Expect = 2e-19 Identities = 52/96 (54%), Positives = 67/96 (69%) Frame = -2 Query: 301 FPSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALG 122 F S S C LI L KSKNYELAFS+Y KMTHV I P+F+S S +I FV+ K A Sbjct: 66 FLSESACTSLIASLVKSKNYELAFSVYIKMTHVGILPSFISLSRLIDCFVHIQKLNFAFA 125 Query: 121 VVGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAMEL 14 V+G +LKRGF V++++MNL+LK LC+N + EA+ L Sbjct: 126 VLGLILKRGFVVSSYIMNLMLKGLCRNGKAFEAIYL 161 >ref|XP_002313262.2| hypothetical protein POPTR_0009s07380g [Populus trichocarpa] gi|550331224|gb|EEE87217.2| hypothetical protein POPTR_0009s07380g [Populus trichocarpa] Length = 648 Score = 99.8 bits (247), Expect = 7e-19 Identities = 48/87 (55%), Positives = 65/87 (74%) Frame = -2 Query: 262 LTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGVVGSVLKRGFRVN 83 L KSK+YELAFS+Y +MTHV + P+F+S S +I FV KPQLALGV+G + KRGF V Sbjct: 4 LVKSKHYELAFSVYSRMTHVGVLPSFISLSGLIDSFVFAKKPQLALGVLGLIFKRGFIVG 63 Query: 82 AFVMNLILKSLCQNNEVEEAMELYSIM 2 + +N+ILK LC+N EV A++L++ M Sbjct: 64 VYNINVILKGLCRNKEVYGALDLFNRM 90 >ref|XP_004244115.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] gi|723718312|ref|XP_010324314.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] gi|723718315|ref|XP_010324315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] Length = 737 Score = 99.8 bits (247), Expect = 7e-19 Identities = 46/94 (48%), Positives = 65/94 (69%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS S CNFL+ L KSK Y LA +Y+K V + P F+S + +I FV +KP+LA+GV Sbjct: 79 PSESTCNFLVVTLAKSKEYNLALRVYRKTRQVQVLPRFLSLAALIECFVYVHKPKLAIGV 138 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQNNEVEEAME 17 +G +LK GF+VN +V+N+ILK LC+N V A++ Sbjct: 139 LGLMLKNGFKVNVYVVNVILKGLCENGMVVNAIK 172 >ref|XP_004492420.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] gi|828298418|ref|XP_012569019.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] gi|828298421|ref|XP_012569020.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] gi|828298423|ref|XP_012569021.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] Length = 721 Score = 97.4 bits (241), Expect = 4e-18 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 1/100 (1%) Frame = -2 Query: 298 PSPSYCNFLICELTKSKNYELAFSIYKKMTHVHIFPNFVSFSCVIAYFVNENKPQLALGV 119 PS S+CN LI L K+K+Y+L S++ KM V IFP F S S +I FVN K A GV Sbjct: 64 PSYSFCNTLIDNLRKAKHYDLVISVHSKMVSVSIFPCFTSLSALIESFVNTQKSSFAFGV 123 Query: 118 VGSVLKRGFRVNAFVMNLILKSLCQ-NNEVEEAMELYSIM 2 +G ++KRG+ VN + MNL+LK CQ + + ++A++L+SIM Sbjct: 124 LGLMIKRGYDVNVYNMNLLLKGFCQIDGDCDKALDLFSIM 163 >ref|XP_008219082.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Prunus mume] gi|645224385|ref|XP_008219083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Prunus mume] Length = 626 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/71 (61%), Positives = 59/71 (83%) Frame = -2 Query: 214 MTHVHIFPNFVSFSCVIAYFVNENKPQLALGVVGSVLKRGFRVNAFVMNLILKSLCQNNE 35 MTHV IFP+F+S SC++A FVN N + A GV+G VLKRGF++N +V+NL+LK LC N+E Sbjct: 1 MTHVGIFPSFISLSCLVACFVNTNHAKFAPGVLGLVLKRGFQLNVYVVNLMLKGLCSNDE 60 Query: 34 VEEAMELYSIM 2 VE+AMEL+S+M Sbjct: 61 VEKAMELFSVM 71