BLASTX nr result
ID: Ziziphus21_contig00039005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039005 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013899184.1| AP-1 complex subunit beta-1 [Monoraphidium n... 57 7e-06 >ref|XP_013899184.1| AP-1 complex subunit beta-1 [Monoraphidium neglectum] gi|761969083|gb|KIZ00165.1| AP-1 complex subunit beta-1 [Monoraphidium neglectum] Length = 368 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/62 (48%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = -3 Query: 240 VAQTNEEVLYITGKAATVDS--PTQLLLEVRYSKAAPGIKAFTKSTRPDLAPFVFDALPA 67 V T ++ LY+T + V PTQLLLE+R ++ APG+ A K RPDLAP VFDA+ Sbjct: 305 VPGTGQDALYVTARLPGVAGAPPTQLLLELRLTRGAPGVDAAFKCQRPDLAPLVFDAVDK 364 Query: 66 LL 61 L Sbjct: 365 AL 366