BLASTX nr result
ID: Ziziphus21_contig00038628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038628 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 94 3e-17 ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 59 3e-12 ref|XP_013442822.1| NADH-quinone oxidoreductase protein [Medicag... 51 9e-08 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 93 IVHRYSSMQRGRDDVTYYDHVQKCCPSARQYGTSQQLPFLYE 218 IVHRYSSMQRGRDDVTYYDHVQKCCPSARQYGTSQQLPFLYE Sbjct: 346 IVHRYSSMQRGRDDVTYYDHVQKCCPSARQYGTSQQLPFLYE 387 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 59.3 bits (142), Expect(2) = 3e-12 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 FQFTDKEDRVGVGVYDVVLKYDPGRYMLTM 3 F+FTDKEDRV VGVY+V+LKYDPGRYMLTM Sbjct: 393 FRFTDKEDRVRVGVYNVILKYDPGRYMLTM 422 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -1 Query: 142 YVTSSRPRCIEEYLCTI 92 Y+TSSRPRCIEEYLCT+ Sbjct: 376 YITSSRPRCIEEYLCTM 392 >ref|XP_013442822.1| NADH-quinone oxidoreductase protein [Medicago truncatula] gi|657370786|gb|KEH16847.1| NADH-quinone oxidoreductase protein [Medicago truncatula] Length = 346 Score = 51.2 bits (121), Expect(2) = 9e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 207 TGAVERFHIAEPKGSTSVRDRSMSRR 130 TGAV+RFHIAEPKGSTSVRDRSMS R Sbjct: 21 TGAVDRFHIAEPKGSTSVRDRSMSSR 46 Score = 31.6 bits (70), Expect(2) = 9e-08 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 133 SSRPRCIEEYLCTISSSL 80 SSRPRCIE+YLC+I L Sbjct: 44 SSRPRCIEKYLCSIPPML 61