BLASTX nr result
ID: Ziziphus21_contig00038586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038586 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008238352.1| PREDICTED: tobamovirus multiplication protei... 57 5e-06 ref|XP_008238350.1| PREDICTED: tobamovirus multiplication protei... 57 5e-06 ref|XP_008238348.1| PREDICTED: tobamovirus multiplication protei... 57 5e-06 >ref|XP_008238352.1| PREDICTED: tobamovirus multiplication protein 2B isoform X5 [Prunus mume] Length = 129 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -1 Query: 302 SVPHLQTVIQLLTNMESCQLSSLSKAPCFQEVKISPS 192 SVPHLQTVIQLL NMESCQLSSLS+A EVKIS S Sbjct: 88 SVPHLQTVIQLLENMESCQLSSLSQAKVLPEVKISLS 124 >ref|XP_008238350.1| PREDICTED: tobamovirus multiplication protein 2B isoform X3 [Prunus mume] Length = 138 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -1 Query: 302 SVPHLQTVIQLLTNMESCQLSSLSKAPCFQEVKISPS 192 SVPHLQTVIQLL NMESCQLSSLS+A EVKIS S Sbjct: 88 SVPHLQTVIQLLENMESCQLSSLSQAKVLPEVKISLS 124 >ref|XP_008238348.1| PREDICTED: tobamovirus multiplication protein 2B isoform X1 [Prunus mume] Length = 182 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -1 Query: 302 SVPHLQTVIQLLTNMESCQLSSLSKAPCFQEVKISPS 192 SVPHLQTVIQLL NMESCQLSSLS+A EVKIS S Sbjct: 88 SVPHLQTVIQLLENMESCQLSSLSQAKVLPEVKISLS 124