BLASTX nr result
ID: Ziziphus21_contig00036485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036485 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442832.1| hypothetical protein MTR_0082s0170 [Medicago... 60 5e-07 >ref|XP_013442832.1| hypothetical protein MTR_0082s0170 [Medicago truncatula] gi|657370796|gb|KEH16857.1| hypothetical protein MTR_0082s0170 [Medicago truncatula] Length = 73 Score = 60.5 bits (145), Expect = 5e-07 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 17/63 (26%) Frame = -2 Query: 139 MQPQPERSTCKFSETE--------------LNRIVTFHAC*---KSKKEGPFSHVVRRSN 11 MQPQPERSTC E +NRIVTF C K +KEGPFSHVVRRSN Sbjct: 1 MQPQPERSTCAAGGAERTNPRLASFPKPNFINRIVTFKKCLLKIKERKEGPFSHVVRRSN 60 Query: 10 QRF 2 QRF Sbjct: 61 QRF 63