BLASTX nr result
ID: Ziziphus21_contig00036483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036483 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106191.1| hypothetical protein L484_009615 [Morus nota... 64 3e-08 >ref|XP_010106191.1| hypothetical protein L484_009615 [Morus notabilis] gi|587921049|gb|EXC08472.1| hypothetical protein L484_009615 [Morus notabilis] Length = 592 Score = 64.3 bits (155), Expect = 3e-08 Identities = 41/84 (48%), Positives = 48/84 (57%) Frame = -2 Query: 254 SSSLKPESVQNKFLKMDGPRLVGAKSSKEDDAEVVGSNKTKLVKVIRVPTVGKDVACSSQ 75 SS E VQ D R+VGA S+ED AEV S +T+ K +RVP KD SS Sbjct: 353 SSIPNAEPVQTGSNVEDDTRVVGANFSREDGAEVAVSTETQSGKGVRVPLTRKDTTSSSH 412 Query: 74 NDENVLDGNTGGNESLSVSAKQNI 3 DEN+ D NT GNE SV AKQN+ Sbjct: 413 IDENMTDKNTRGNE--SVPAKQNV 434