BLASTX nr result
ID: Ziziphus21_contig00036263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036263 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212842.1| hypothetical protein PRUPE_ppa020792mg [Prun... 64 6e-08 ref|XP_008225273.1| PREDICTED: U-box domain-containing protein 7... 61 4e-07 ref|XP_009348793.1| PREDICTED: U-box domain-containing protein 7... 60 6e-07 ref|XP_008371459.1| PREDICTED: U-box domain-containing protein 7... 57 5e-06 ref|XP_010103043.1| hypothetical protein L484_005798 [Morus nota... 57 7e-06 >ref|XP_007212842.1| hypothetical protein PRUPE_ppa020792mg [Prunus persica] gi|462408707|gb|EMJ14041.1| hypothetical protein PRUPE_ppa020792mg [Prunus persica] Length = 448 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = -1 Query: 227 PIWLYSYIKLKFFNRIRRFLRSKTARKRCMTTVGFQTPKPNSKGVITCNN 78 PIWLYSYIKL+FFNRIRRFLRSK ARKR + F T VI+ NN Sbjct: 15 PIWLYSYIKLRFFNRIRRFLRSKNARKRPTPSDHFDTSSSRPAKVISNNN 64 >ref|XP_008225273.1| PREDICTED: U-box domain-containing protein 7 [Prunus mume] Length = 448 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/50 (62%), Positives = 34/50 (68%) Frame = -1 Query: 227 PIWLYSYIKLKFFNRIRRFLRSKTARKRCMTTVGFQTPKPNSKGVITCNN 78 PIWLYSYIKL+FFNRIRRFL SK ARKR + F T VI+ NN Sbjct: 15 PIWLYSYIKLRFFNRIRRFLLSKNARKRPTPSDHFDTSSSRPAKVISNNN 64 >ref|XP_009348793.1| PREDICTED: U-box domain-containing protein 7-like [Pyrus x bretschneideri] Length = 444 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 227 PIWLYSYIKLKFFNRIRRFLRSKTARKRCMTTVGFQTPKPNSKGVITCN 81 P+W+YSYIKL+FFNR+RRFLRSK+ARKR + F T SK V N Sbjct: 16 PLWVYSYIKLRFFNRVRRFLRSKSARKRPTPSDHFDTSSRPSKVVSNSN 64 >ref|XP_008371459.1| PREDICTED: U-box domain-containing protein 7-like [Malus domestica] Length = 444 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 227 PIWLYSYIKLKFFNRIRRFLRSKTARKRCMTTVGFQTPKPNSKGVITCN 81 P+W+YSYIKL+FFNR++RFLRSK+ARKR + F T S+ V N Sbjct: 16 PLWVYSYIKLRFFNRVQRFLRSKSARKRPTPSDHFDTSSRPSEVVSNSN 64 >ref|XP_010103043.1| hypothetical protein L484_005798 [Morus notabilis] gi|587906580|gb|EXB94641.1| hypothetical protein L484_005798 [Morus notabilis] Length = 451 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 227 PIWLYSYIKLKFFNRIRRFLRSKTARKR 144 PIWLYSYIKL+FFNRIRRFLRSK RKR Sbjct: 17 PIWLYSYIKLRFFNRIRRFLRSKAGRKR 44