BLASTX nr result
ID: Ziziphus21_contig00036153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036153 (236 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010099509.1| hypothetical protein L484_009946 [Morus nota... 60 6e-07 >ref|XP_010099509.1| hypothetical protein L484_009946 [Morus notabilis] gi|587890717|gb|EXB79360.1| hypothetical protein L484_009946 [Morus notabilis] Length = 164 Score = 60.1 bits (144), Expect = 6e-07 Identities = 35/78 (44%), Positives = 43/78 (55%), Gaps = 6/78 (7%) Frame = -2 Query: 232 IVCKDGECSGNNRKLIXXXXXXXXXXXSKREKNGTNKAEPISNEQKG-NRQRVEEENFTV 56 +VCKDG CSGNNRKL+ +K EKNG KA PISN +KG NR + Sbjct: 61 VVCKDGNCSGNNRKLLSVTPSTTTTTTAKNEKNGKTKANPISNGEKGTNRSQNYGHGEEE 120 Query: 55 KSSEAT-----SDDEHRE 17 KSS +T + +EH E Sbjct: 121 KSSSSTVNSLSTSEEHPE 138