BLASTX nr result
ID: Ziziphus21_contig00036053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036053 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77235.1| hypothetical protein VITISV_010062 [Vitis vinifera] 69 4e-10 >emb|CAN77235.1| hypothetical protein VITISV_010062 [Vitis vinifera] Length = 688 Score = 68.6 bits (166), Expect(2) = 4e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 199 IKVDGINYRVWSQISEMHIVGRKKKGYITGIETAPKESDPSY 74 IK+DG NY VWSQI +MHIVG KKKGYITG + AP E+DP+Y Sbjct: 14 IKLDGTNYSVWSQILDMHIVGXKKKGYITGTKVAPVENDPNY 55 Score = 22.3 bits (46), Expect(2) = 4e-10 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 74 YDEWEAEYALVRS 36 YDEW+ E LV+S Sbjct: 55 YDEWKVEDVLVKS 67