BLASTX nr result
ID: Ziziphus21_contig00035969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035969 (274 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012458306.1| PREDICTED: uncharacterized protein LOC105779... 43 8e-06 >ref|XP_012458306.1| PREDICTED: uncharacterized protein LOC105779104 [Gossypium raimondii] Length = 247 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 17/38 (44%), Positives = 30/38 (78%) Frame = -3 Query: 158 IVNCYATKSHSRVLHYRKLLHNTKKNDLSTENYILKMK 45 IVN Y +K+ SR++ YR+ LH+ +K DLS +++++K+K Sbjct: 130 IVNLYNSKTTSRLMFYRRALHSQRKGDLSMKDFLIKIK 167 Score = 33.5 bits (75), Expect(2) = 8e-06 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 273 EDWEIQDQFLIGWLKGTIDRKVIGHFLGADTTHKLW 166 E +E QD WL ++ + V+ H +G DT+ K+W Sbjct: 92 ERFEQQDSAPASWLLSSVSQTVLPHLIGMDTSAKIW 127