BLASTX nr result
ID: Ziziphus21_contig00035940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035940 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011401258.1| Glycine cleavage system H protein, mitochond... 64 4e-08 ref|WP_019434284.1| glycine cleavage system protein H [Streptomy... 64 6e-08 ref|WP_043108915.1| glycine cleavage system protein H [endosymbi... 63 8e-08 ref|WP_033214799.1| glycine cleavage system protein H [Kitasatos... 62 1e-07 ref|WP_030919412.1| MULTISPECIES: glycine cleavage system protei... 62 1e-07 ref|WP_014138165.1| glycine cleavage system protein H [Kitasatos... 62 1e-07 ref|WP_017546423.1| MULTISPECIES: glycine cleavage system protei... 62 2e-07 ref|WP_026556908.1| glycine cleavage system protein H [Arthrobac... 62 2e-07 ref|WP_031172866.1| glycine cleavage system protein H [Streptomy... 61 3e-07 ref|WP_030460864.1| glycine cleavage system protein H [Kitasatos... 61 3e-07 ref|WP_057232669.1| MULTISPECIES: glycine cleavage system protei... 61 4e-07 gb|AKN69926.1| glycine cleavage system protein H [Streptomyces s... 61 4e-07 ref|WP_030392723.1| MULTISPECIES: glycine cleavage system protei... 61 4e-07 ref|WP_021474486.1| glycine cleavage system protein H [Arthrobac... 61 4e-07 ref|WP_055493608.1| glycine cleavage system protein H [Streptomy... 60 5e-07 gb|ALE92891.1| glycine cleavage system protein H [Arthrobacter a... 60 5e-07 ref|WP_053662918.1| glycine cleavage system protein H [Streptomy... 60 5e-07 dbj|GAP58656.1| glycine cleavage system H protein [Arthrobacter ... 60 5e-07 dbj|GAN04629.1| glycine cleavage system protein H [Mucor ambiguus] 60 5e-07 ref|WP_030959666.1| glycine cleavage system protein H [Streptomy... 60 5e-07 >ref|XP_011401258.1| Glycine cleavage system H protein, mitochondrial [Auxenochlorella protothecoides] gi|675355805|gb|KFM28245.1| Glycine cleavage system H protein, mitochondrial [Auxenochlorella protothecoides] Length = 170 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/60 (48%), Positives = 38/60 (63%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMFXXXXXXXXXXXXXXXXXAYEKHCES 101 D+YSP++GEV EVN ALVD+PAK+N++PF GGW+ AY+KH ES Sbjct: 108 DIYSPLSGEVIEVNSALVDDPAKINAEPFEGGWLAKIKLSDPSEADSLLDANAYKKHVES 167 >ref|WP_019434284.1| glycine cleavage system protein H [Streptomyces sp. AA0539] Length = 126 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTEVN A+V+EPA VNS+PF+GGW+F Sbjct: 68 DLYSPVTGEVTEVNAAVVEEPALVNSEPFAGGWLF 102 >ref|WP_043108915.1| glycine cleavage system protein H [endosymbiont of unidentified scaly snail isolate Monju] gi|530671748|dbj|BAN70164.1| glycine cleavage system H protein [endosymbiont of unidentified scaly snail isolate Monju] Length = 131 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/60 (46%), Positives = 35/60 (58%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMFXXXXXXXXXXXXXXXXXAYEKHCES 101 DVY P++GEV E+NEALVD P +NSDP+ GWMF AY +HCE+ Sbjct: 69 DVYCPVSGEVVEINEALVDAPETINSDPYDAGWMFKLKVVDQGEAEGLMDASAYAEHCEN 128 >ref|WP_033214799.1| glycine cleavage system protein H [Kitasatospora phosalacinea] Length = 124 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D++SP TGEVTEVN+A++DEPA VNS+PF GGW+F Sbjct: 68 DLFSPATGEVTEVNQAVIDEPALVNSEPFEGGWLF 102 >ref|WP_030919412.1| MULTISPECIES: glycine cleavage system protein H [Streptomycetaceae] Length = 124 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D++SP TGEVTEVN+A++DEPA VNS+PF GGW+F Sbjct: 68 DLFSPATGEVTEVNQAVIDEPALVNSEPFEGGWLF 102 >ref|WP_014138165.1| glycine cleavage system protein H [Kitasatospora setae] gi|311898458|dbj|BAJ30866.1| putative glycine cleavage system H protein [Kitasatospora setae KM-6054] Length = 124 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP TGEVTEVN+A++DEPA VNS PF GGW+F Sbjct: 68 DLYSPATGEVTEVNQAVIDEPALVNSAPFEGGWLF 102 >ref|WP_017546423.1| MULTISPECIES: glycine cleavage system protein H [Nocardiopsis] Length = 126 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEV EVNEAL D P +NSDPF GGW+F Sbjct: 67 DIYSPVTGEVVEVNEALEDAPETINSDPFEGGWLF 101 >ref|WP_026556908.1| glycine cleavage system protein H [Arthrobacter sp. 35W] Length = 127 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTEVN A+VD+PA +NSDP+ GW+F Sbjct: 69 DLYSPVTGEVTEVNSAVVDDPALINSDPYGAGWLF 103 >ref|WP_031172866.1| glycine cleavage system protein H [Streptomyces durhamensis] Length = 125 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGE+TE+NE +V++P+ VNSDPF GGW+F Sbjct: 68 DLYSPVTGEITEINEDVVNDPSLVNSDPFEGGWLF 102 >ref|WP_030460864.1| glycine cleavage system protein H [Kitasatospora sp. NRRL B-11411] Length = 124 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP TG VTEVN+A++DEPA VNS+PF GGW+F Sbjct: 68 DLYSPATGVVTEVNQAVIDEPALVNSEPFEGGWLF 102 >ref|WP_057232669.1| MULTISPECIES: glycine cleavage system protein H [Kitasatospora] gi|945461332|gb|KQV17350.1| glycine cleavage system protein H [Kitasatospora sp. Root107] gi|946113287|gb|KRB65560.1| glycine cleavage system protein H [Kitasatospora sp. Root187] Length = 124 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTE+N+A++D+PA VNSDPF W+F Sbjct: 68 DLYSPVTGEVTEINQAVIDDPASVNSDPFGEAWLF 102 >gb|AKN69926.1| glycine cleavage system protein H [Streptomyces sp. PBH53] Length = 125 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTEVNE +VD+P+ VNS PF GGW+F Sbjct: 68 DLYSPVTGEVTEVNEDVVDDPSLVNSAPFEGGWLF 102 >ref|WP_030392723.1| MULTISPECIES: glycine cleavage system protein H [Streptomycetaceae] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGE+TEVNEA+ D+ + VNSDPF GGW+F Sbjct: 69 DLYSPVTGEITEVNEAVADDNSLVNSDPFEGGWLF 103 >ref|WP_021474486.1| glycine cleavage system protein H [Arthrobacter sp. AK-YN10] gi|542106595|gb|ERI35573.1| glycine cleavage system protein H [Arthrobacter sp. AK-YN10] Length = 127 Score = 60.8 bits (146), Expect = 4e-07 Identities = 22/35 (62%), Positives = 32/35 (91%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTE+N+A+VD+PA +N+DP+ GW+F Sbjct: 69 DLYSPVTGEVTEINDAVVDDPALINNDPYGAGWLF 103 >ref|WP_055493608.1| glycine cleavage system protein H [Streptomyces sp. TP-A0356] Length = 125 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTE+NE +VD+P+ VNS PF GGW+F Sbjct: 68 DLYSPVTGEVTEINEDVVDDPSLVNSAPFEGGWLF 102 >gb|ALE92891.1| glycine cleavage system protein H [Arthrobacter alpinus] Length = 127 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTEVN A VD+PA +NSDP+ GW+F Sbjct: 69 DLYSPVTGEVTEVNTAAVDDPALINSDPYGAGWLF 103 >ref|WP_053662918.1| glycine cleavage system protein H [Streptomyces sp. MMG1121] gi|925534219|gb|KOV61679.1| glycine cleavage system protein H [Streptomyces sp. MMG1121] Length = 128 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGE+TEVNE +VD+P+ VNS PF GGW+F Sbjct: 68 DLYSPVTGEITEVNEDVVDDPSLVNSAPFEGGWLF 102 >dbj|GAP58656.1| glycine cleavage system H protein [Arthrobacter sp. Hiyo1] Length = 127 Score = 60.5 bits (145), Expect = 5e-07 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGEVTEVN A+VD+PA +N+DP+ GW+F Sbjct: 69 DLYSPVTGEVTEVNSAVVDDPALINNDPYGAGWLF 103 >dbj|GAN04629.1| glycine cleavage system protein H [Mucor ambiguus] Length = 158 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/64 (42%), Positives = 36/64 (56%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMFXXXXXXXXXXXXXXXXXAYEKHCES 101 D+YSP++GE+ VNEAL DEP+ +NS P GW+ AYE HC++ Sbjct: 95 DIYSPVSGEIVNVNEALSDEPSLINSSPEEDGWLAKIKISNESELEGLMDESAYEAHCDA 154 Query: 100 AGDH 89 A DH Sbjct: 155 AEDH 158 >ref|WP_030959666.1| glycine cleavage system protein H [Streptomyces sp. NRRL F-5140] Length = 125 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 280 DVYSPITGEVTEVNEALVDEPAKVNSDPFSGGWMF 176 D+YSP+TGE+TE+NE +V+EPA VNS PF GGW+F Sbjct: 68 DLYSPVTGEITEINEDVVNEPALVNSAPFEGGWLF 102