BLASTX nr result
ID: Ziziphus21_contig00035906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035906 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096057.1| hypothetical protein L484_008713 [Morus nota... 62 2e-07 >ref|XP_010096057.1| hypothetical protein L484_008713 [Morus notabilis] gi|587873687|gb|EXB62863.1| hypothetical protein L484_008713 [Morus notabilis] Length = 242 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 3/65 (4%) Frame = -2 Query: 194 ALSFGLCLPFHPLIREILSRLQLAPIQLVPNCWRIMLGTLAVNRICNV---NLGWNEFCY 24 A +GL LPFHP IR +L+ LAP QL PN WR M G + + RIC+ ++ +EF + Sbjct: 61 AFEYGLRLPFHPFIRTVLAHFDLAPTQLSPNVWRHMAGAIILWRICSEEKDHITLDEFNF 120 Query: 23 CYVAK 9 CY+ + Sbjct: 121 CYMLR 125