BLASTX nr result
ID: Ziziphus21_contig00035853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035853 (576 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588284.1| hypothetical protein ZeamMp020 (mitochondrion) ... 59 2e-12 >ref|YP_588284.1| hypothetical protein ZeamMp020 (mitochondrion) [Zea mays subsp. mays] gi|94502700|ref|YP_588308.1| hypothetical protein ZeamMp046 (mitochondrion) [Zea mays subsp. mays] gi|40795138|gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gi|40795139|gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 59.3 bits (142), Expect(2) = 2e-12 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 223 GIRSKLASLFDHFDRGGWRKWTKQTRISQSKRWVPFSSR 107 G + L LF HF RGGW KW KQT I QSKRWVPFSSR Sbjct: 7 GNKKHLKCLFYHFYRGGWIKWAKQTHIFQSKRWVPFSSR 45 Score = 40.0 bits (92), Expect(2) = 2e-12 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -1 Query: 87 RKKNNIENVPNPPTPSFVEPCIVSDPNPP 1 ++KN++EN PNP FV PCIVSDPN P Sbjct: 46 QRKNHLENAPNP----FVGPCIVSDPNLP 70