BLASTX nr result
ID: Ziziphus21_contig00035835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035835 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012078858.1| PREDICTED: glutathione S-transferase zeta cl... 56 9e-06 >ref|XP_012078858.1| PREDICTED: glutathione S-transferase zeta class-like [Jatropha curcas] gi|643722714|gb|KDP32464.1| hypothetical protein JCGZ_13389 [Jatropha curcas] Length = 223 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 242 DEKLLGVQYHIGKGIASLEKLLKDCAGRYATGDEFF 135 DEK+ VQYH+ KG A+LEKLLKD AG+YATGDE F Sbjct: 132 DEKIPWVQYHVQKGFAALEKLLKDHAGKYATGDEVF 167