BLASTX nr result
ID: Ziziphus21_contig00035729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035729 (715 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853271.1| PREDICTED: uncharacterized protein LOC105972... 59 3e-06 >ref|XP_012853271.1| PREDICTED: uncharacterized protein LOC105972835 [Erythranthe guttatus] Length = 124 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/60 (41%), Positives = 38/60 (63%) Frame = -1 Query: 520 CETPRPIVVRTSKTIVNLRRRFYSCDTHKDTGGCRFFKWINAPMSDNARNVVDQLRHKIH 341 C R +++TS T +NL RRF C +K GGC+++ WI+ PM D +RN++ L KI+ Sbjct: 13 CYCARMAIMKTSWTDLNLGRRFAICPKYKQIGGCKYYVWIDPPMCDRSRNIIPGLLRKIN 72