BLASTX nr result
ID: Ziziphus21_contig00035584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035584 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008393508.1| PREDICTED: putative pentatricopeptide repeat... 75 3e-11 ref|XP_008240346.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_012079321.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 gb|KHN12122.1| Pentatricopeptide repeat-containing protein [Glyc... 69 2e-09 ref|XP_006573919.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_012485114.1| PREDICTED: putative pentatricopeptide repeat... 66 9e-09 gb|KJB35383.1| hypothetical protein B456_006G112200 [Gossypium r... 66 9e-09 ref|XP_010037018.1| PREDICTED: putative pentatricopeptide repeat... 66 9e-09 gb|KCW48655.1| hypothetical protein EUGRSUZ_K02312 [Eucalyptus g... 66 9e-09 ref|XP_004297001.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_008467246.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_009792118.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-08 ref|XP_009630492.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-08 ref|XP_007157240.1| hypothetical protein PHAVU_002G054500g [Phas... 63 8e-08 ref|XP_011650978.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 emb|CDO98572.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_008811007.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_007210175.1| hypothetical protein PRUPE_ppa018038mg, part... 62 2e-07 ref|XP_014519518.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010271815.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 >ref|XP_008393508.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Malus domestica] Length = 594 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVENSRLLSAL 160 YVLLSN+ AG+SNWD GMLR+LME RDVQK+PGSSWIEVE + S L Sbjct: 546 YVLLSNIFAGLSNWDDVGMLRKLMEARDVQKVPGSSWIEVEKGQASSPL 594 >ref|XP_008240346.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Prunus mume] Length = 586 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 YVLLSNM AG+SNWD AGMLR+LME RDV+K+PGSSWIE+E Sbjct: 543 YVLLSNMFAGLSNWDSAGMLRKLMESRDVKKLPGSSWIEIE 583 >ref|XP_012079321.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Jatropha curcas] gi|643740120|gb|KDP45806.1| hypothetical protein JCGZ_17413 [Jatropha curcas] Length = 590 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 YVLLSNM AGI NWD GMLR++ME RDV+K+PGSSWIEVE Sbjct: 544 YVLLSNMFAGIKNWDSVGMLRKIMENRDVKKVPGSSWIEVE 584 >gb|KHN12122.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 513 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 Y+LLSNM A SNWDG +LRELME RDVQK+PGSSWIE+E Sbjct: 471 YLLLSNMFAEFSNWDGVVILRELMETRDVQKLPGSSWIEIE 511 >ref|XP_006573919.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] gi|947130126|gb|KRH77980.1| hypothetical protein GLYMA_01G245300 [Glycine max] Length = 593 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 Y+LLSNM A SNWDG +LRELME RDVQK+PGSSWIE+E Sbjct: 551 YLLLSNMFAEFSNWDGVVILRELMETRDVQKLPGSSWIEIE 591 >ref|XP_012485114.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Gossypium raimondii] Length = 927 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 YVLLSNM AG +NWD G LRELME RDV+K+PG+SWI++E Sbjct: 868 YVLLSNMFAGFNNWDDVGKLRELMETRDVKKVPGTSWIKLE 908 >gb|KJB35383.1| hypothetical protein B456_006G112200 [Gossypium raimondii] Length = 988 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 YVLLSNM AG +NWD G LRELME RDV+K+PG+SWI++E Sbjct: 929 YVLLSNMFAGFNNWDDVGKLRELMETRDVKKVPGTSWIKLE 969 >ref|XP_010037018.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Eucalyptus grandis] Length = 600 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVENS 178 YVLLSNM AG+ NWDG GM+RELM DV+K+PGSSWI E S Sbjct: 550 YVLLSNMFAGLRNWDGVGMMRELMGTSDVRKLPGSSWIGQEKS 592 >gb|KCW48655.1| hypothetical protein EUGRSUZ_K02312 [Eucalyptus grandis] Length = 500 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVENS 178 YVLLSNM AG+ NWDG GM+RELM DV+K+PGSSWI E S Sbjct: 450 YVLLSNMFAGLRNWDGVGMMRELMGTSDVRKLPGSSWIGQEKS 492 >ref|XP_004297001.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Fragaria vesca subsp. vesca] Length = 580 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIE 190 Y+LLSN+ AG+SNWD G+LR+LM+ RDV+K+PGSSWIE Sbjct: 541 YILLSNIFAGLSNWDSVGLLRKLMDSRDVKKLPGSSWIE 579 >ref|XP_008467246.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis melo] Length = 599 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWI 193 Y+LLSNM AG +NWDG G LRELME RDV+K+PGSSW+ Sbjct: 554 YILLSNMFAGGNNWDGVGSLRELMETRDVKKVPGSSWM 591 >ref|XP_009792118.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana sylvestris] Length = 602 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWI 193 YVLLSN AG+ NWDG G LRELM+ RDV+K+PGSSW+ Sbjct: 565 YVLLSNTFAGLQNWDGVGTLRELMQSRDVKKVPGSSWL 602 >ref|XP_009630492.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana tomentosiformis] Length = 601 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWI 193 YVLLSN AG+ NWDG G LRELM+ RDV+K+PGSSW+ Sbjct: 564 YVLLSNTFAGLQNWDGVGTLRELMQSRDVKKVPGSSWL 601 >ref|XP_007157240.1| hypothetical protein PHAVU_002G054500g [Phaseolus vulgaris] gi|561030655|gb|ESW29234.1| hypothetical protein PHAVU_002G054500g [Phaseolus vulgaris] Length = 582 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVE 184 Y+LLSNM A SNWDG +LR+LME++DV+K+PGSSWIE++ Sbjct: 542 YLLLSNMFAECSNWDGVLILRQLMEMKDVKKVPGSSWIEID 582 >ref|XP_011650978.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Cucumis sativus] gi|700209110|gb|KGN64206.1| hypothetical protein Csa_1G043090 [Cucumis sativus] Length = 599 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWI 193 Y+LLSNM AG NWD G+LRELME RDV+K+PGSSW+ Sbjct: 554 YILLSNMFAGGDNWDSVGILRELMETRDVKKVPGSSWM 591 >emb|CDO98572.1| unnamed protein product [Coffea canephora] Length = 613 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVENS 178 YVLLSN A +NWD G+LRE+ME +DV+KMPGSSWIE++ + Sbjct: 560 YVLLSNTFASSNNWDSVGILREVMESQDVKKMPGSSWIELDRN 602 >ref|XP_008811007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Phoenix dactylifera] Length = 603 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIE 190 YVLLSNM A NWDG G +RELME R+V+K+PG+SWIE Sbjct: 548 YVLLSNMFANTDNWDGVGRIRELMEDREVKKVPGTSWIE 586 >ref|XP_007210175.1| hypothetical protein PRUPE_ppa018038mg, partial [Prunus persica] gi|462405910|gb|EMJ11374.1| hypothetical protein PRUPE_ppa018038mg, partial [Prunus persica] Length = 577 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGS 202 YVLLSNM AG+SNWD AGMLR+LME RDV+K+PGS Sbjct: 543 YVLLSNMFAGLSNWDSAGMLRKLMESRDVKKLPGS 577 >ref|XP_014519518.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Vigna radiata var. radiata] Length = 582 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIE 190 Y+LLSNM A SNWDG ++RELME++DV+K+PGSSWIE Sbjct: 543 YLLLSNMFAEYSNWDGVLIMRELMEMKDVKKVPGSSWIE 581 >ref|XP_010271815.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Nelumbo nucifera] Length = 593 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 306 YVLLSNMHAGISNWDGAGMLRELMEIRDVQKMPGSSWIEVENSR 175 Y+LLSNM A NWD G LRELME R+V+K+PG SWIEV ++ Sbjct: 542 YLLLSNMFADFGNWDNVGKLRELMETREVKKVPGCSWIEVTGNQ 585