BLASTX nr result
ID: Ziziphus21_contig00035510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035510 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109634.1| hypothetical protein L484_015589 [Morus nota... 98 2e-18 ref|XP_012073146.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 ref|XP_008359551.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 gb|KDP37060.1| hypothetical protein JCGZ_06116 [Jatropha curcas] 91 4e-16 ref|XP_007044258.1| Pentatricopeptide repeat (PPR) superfamily p... 90 7e-16 ref|XP_009368106.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_007137795.1| hypothetical protein PHAVU_009G156000g [Phas... 88 2e-15 gb|KDO50719.1| hypothetical protein CISIN_1g005265mg [Citrus sin... 87 4e-15 ref|XP_006432168.1| hypothetical protein CICLE_v10000448mg [Citr... 87 4e-15 ref|XP_007204096.1| hypothetical protein PRUPE_ppa002338mg [Prun... 87 4e-15 gb|KRH29681.1| hypothetical protein GLYMA_11G131400 [Glycine max] 87 5e-15 gb|KHN21887.1| Pentatricopeptide repeat-containing protein [Glyc... 87 5e-15 ref|XP_002310520.1| pentatricopeptide repeat-containing family p... 87 5e-15 ref|XP_014492252.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 gb|KOM41056.1| hypothetical protein LR48_Vigan04g125400 [Vigna a... 86 8e-15 ref|XP_008240562.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_008387316.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_011654450.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_004149135.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_011022929.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 >ref|XP_010109634.1| hypothetical protein L484_015589 [Morus notabilis] gi|587936854|gb|EXC23679.1| hypothetical protein L484_015589 [Morus notabilis] Length = 652 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/78 (60%), Positives = 59/78 (75%), Gaps = 2/78 (2%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFG--HEVDEEYSD 146 GCSWIE++G V+VF VKDKRHP+RKEI ++KSL++QMKRAGY+P G +E EE Sbjct: 575 GCSWIELKGRVHVFLVKDKRHPKRKEICSVVKSLLKQMKRAGYVPNPSGSDYEAYEEQCG 634 Query: 145 SEFTSCYTMNTPQYTVAG 92 SEF+SCY M+ PQ AG Sbjct: 635 SEFSSCYIMDMPQEATAG 652 >ref|XP_012073146.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Jatropha curcas] Length = 707 Score = 90.5 bits (223), Expect = 4e-16 Identities = 42/64 (65%), Positives = 49/64 (76%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIE+ GHV+VF VKDKRHP++KEIYLLLK L +QMKRAGY+P HE EE SD + Sbjct: 632 GCSWIEVLGHVHVFMVKDKRHPQKKEIYLLLKILTQQMKRAGYVPDDGDHEAYEEQSDLD 691 Query: 139 FTSC 128 C Sbjct: 692 VGFC 695 >ref|XP_008359551.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Malus domestica] Length = 713 Score = 90.5 bits (223), Expect = 4e-16 Identities = 42/76 (55%), Positives = 56/76 (73%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQGHV+VF VKDKRHP+RKEI+ +LK L+ QM+R+GY+ A E DEE+ +S+ Sbjct: 638 GCSWIEIQGHVHVFLVKDKRHPQRKEIHYVLKLLLEQMRRSGYVEDACDLESDEEHGESQ 697 Query: 139 FTSCYTMNTPQYTVAG 92 TS Y ++ + G Sbjct: 698 LTSLYHIDMLEDAAVG 713 >gb|KDP37060.1| hypothetical protein JCGZ_06116 [Jatropha curcas] Length = 392 Score = 90.5 bits (223), Expect = 4e-16 Identities = 42/64 (65%), Positives = 49/64 (76%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIE+ GHV+VF VKDKRHP++KEIYLLLK L +QMKRAGY+P HE EE SD + Sbjct: 317 GCSWIEVLGHVHVFMVKDKRHPQKKEIYLLLKILTQQMKRAGYVPDDGDHEAYEEQSDLD 376 Query: 139 FTSC 128 C Sbjct: 377 VGFC 380 >ref|XP_007044258.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508708193|gb|EOY00090.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 700 Score = 89.7 bits (221), Expect = 7e-16 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQGHV+VF VKDKRHP+RKEIY +L +L++QMK+AGY+P A E EE S+SE Sbjct: 630 GCSWIEIQGHVSVFMVKDKRHPQRKEIYSVLNALIKQMKQAGYLPDAADQEAYEEESESE 689 >ref|XP_009368106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Pyrus x bretschneideri] gi|694384428|ref|XP_009368107.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Pyrus x bretschneideri] Length = 706 Score = 89.4 bits (220), Expect = 1e-15 Identities = 42/76 (55%), Positives = 56/76 (73%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQGHV+VF VKDKRHP+RKEI+ +LK L+ QMKR+GY+ A E DEE+ +S+ Sbjct: 631 GCSWIEIQGHVHVFLVKDKRHPQRKEIHDVLKLLLEQMKRSGYVEDACDLESDEEHGESQ 690 Query: 139 FTSCYTMNTPQYTVAG 92 T+ Y ++ + G Sbjct: 691 LTALYHIDMLEDAAVG 706 >ref|XP_007137795.1| hypothetical protein PHAVU_009G156000g [Phaseolus vulgaris] gi|561010882|gb|ESW09789.1| hypothetical protein PHAVU_009G156000g [Phaseolus vulgaris] Length = 705 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQ V+VF VKDKRHPRRK+I+L+LK L QMKRAGY+P A E+ EE SDSE Sbjct: 630 GCSWIEIQSRVHVFMVKDKRHPRRKDIHLVLKILTEQMKRAGYVPEADDDEICEEESDSE 689 >gb|KDO50719.1| hypothetical protein CISIN_1g005265mg [Citrus sinensis] Length = 705 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/63 (66%), Positives = 46/63 (73%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEI GHVNVF VKDKRHP KEIYL+LK L R+MKR GY+P A E EE + S Sbjct: 630 GCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSN 689 Query: 139 FTS 131 TS Sbjct: 690 STS 692 >ref|XP_006432168.1| hypothetical protein CICLE_v10000448mg [Citrus clementina] gi|568821173|ref|XP_006465064.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Citrus sinensis] gi|557534290|gb|ESR45408.1| hypothetical protein CICLE_v10000448mg [Citrus clementina] Length = 705 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/63 (66%), Positives = 46/63 (73%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEI GHVNVF VKDKRHP KEIYL+LK L R+MKR GY+P A E EE + S Sbjct: 630 GCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSN 689 Query: 139 FTS 131 TS Sbjct: 690 STS 692 >ref|XP_007204096.1| hypothetical protein PRUPE_ppa002338mg [Prunus persica] gi|462399627|gb|EMJ05295.1| hypothetical protein PRUPE_ppa002338mg [Prunus persica] Length = 685 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/68 (57%), Positives = 53/68 (77%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQG V+VF VKDKRHP+ KEI+ LLK L+ QMK++GY+ A H++ EE+ ++E Sbjct: 610 GCSWIEIQGRVHVFMVKDKRHPQCKEIHYLLKLLIEQMKQSGYVEDACDHDICEEHGETE 669 Query: 139 FTSCYTMN 116 TS Y ++ Sbjct: 670 LTSLYDID 677 >gb|KRH29681.1| hypothetical protein GLYMA_11G131400 [Glycine max] Length = 652 Score = 87.0 bits (214), Expect = 5e-15 Identities = 41/69 (59%), Positives = 50/69 (72%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSW++IQ HV+VF VKDKRHPR+K+I+ +LK L QMK AGY+P A E+ EE SDSE Sbjct: 577 GCSWMKIQSHVHVFMVKDKRHPRKKDIHFVLKFLTEQMKWAGYVPEADDDEICEEESDSE 636 Query: 139 FTSCYTMNT 113 Y M T Sbjct: 637 LVLHYEMET 645 >gb|KHN21887.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 639 Score = 87.0 bits (214), Expect = 5e-15 Identities = 41/69 (59%), Positives = 50/69 (72%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSW++IQ HV+VF VKDKRHPR+K+I+ +LK L QMK AGY+P A E+ EE SDSE Sbjct: 564 GCSWMKIQSHVHVFMVKDKRHPRKKDIHFVLKFLTEQMKWAGYVPEADDDEICEEESDSE 623 Query: 139 FTSCYTMNT 113 Y M T Sbjct: 624 LVLHYEMET 632 >ref|XP_002310520.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222853423|gb|EEE90970.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 710 Score = 87.0 bits (214), Expect = 5e-15 Identities = 39/67 (58%), Positives = 52/67 (77%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWI+IQ +V+VF VKDKRHP++KEIY +LK L + M++AGY+P A HE EE S+ E Sbjct: 635 GCSWIDIQSNVHVFMVKDKRHPQKKEIYSILKLLTKHMRQAGYVPDASDHEAYEEPSELE 694 Query: 139 FTSCYTM 119 +SC+ M Sbjct: 695 SSSCFHM 701 >ref|XP_014492252.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Vigna radiata var. radiata] Length = 705 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/60 (70%), Positives = 47/60 (78%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQ V+VF VKDKRHPRRK+I+L+LK L QMKRAGY+P A E EE SDSE Sbjct: 630 GCSWIEIQSRVHVFMVKDKRHPRRKDIHLVLKILTEQMKRAGYVPEADDDEFCEEESDSE 689 >gb|KOM41056.1| hypothetical protein LR48_Vigan04g125400 [Vigna angularis] Length = 705 Score = 86.3 bits (212), Expect = 8e-15 Identities = 42/60 (70%), Positives = 47/60 (78%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQ V+VF VKDKRHPRRK+I+L+LK L QMKRAGY+P A E EE SDSE Sbjct: 630 GCSWIEIQSRVHVFMVKDKRHPRRKDIHLVLKILTAQMKRAGYVPEADDDEFCEEESDSE 689 >ref|XP_008240562.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Prunus mume] Length = 706 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/68 (57%), Positives = 52/68 (76%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWIEIQG V+VF VKDK HP+ KEI+ LLK L+ QMK++GY+ A HE+ EE+ ++E Sbjct: 631 GCSWIEIQGRVHVFMVKDKSHPQCKEIHYLLKLLIEQMKQSGYVEDACDHEICEEHGETE 690 Query: 139 FTSCYTMN 116 TS Y ++ Sbjct: 691 LTSLYDVD 698 >ref|XP_008387316.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Malus domestica] Length = 706 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/65 (61%), Positives = 50/65 (76%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWI IQGHV+VF VKDKRHP+RKEI+ +LK L+ QM+R+GY A E DEE+ +S+ Sbjct: 631 GCSWIXIQGHVHVFLVKDKRHPQRKEIHYVLKLLLEQMRRSGYXEDACDLESDEEHGZSQ 690 Query: 139 FTSCY 125 TS Y Sbjct: 691 LTSLY 695 >ref|XP_011654450.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 isoform X2 [Cucumis sativus] Length = 599 Score = 85.1 bits (209), Expect = 2e-14 Identities = 35/55 (63%), Positives = 48/55 (87%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEE 155 GCSWIEIQG +NVF VKDKRH R+KEIY++L+++++QMK+AGY+PY +E DE+ Sbjct: 542 GCSWIEIQGELNVFMVKDKRHARKKEIYMVLRTILQQMKQAGYVPYVGSNEFDED 596 >ref|XP_004149135.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 isoform X1 [Cucumis sativus] gi|700194391|gb|KGN49568.1| hypothetical protein Csa_5G003610 [Cucumis sativus] Length = 687 Score = 85.1 bits (209), Expect = 2e-14 Identities = 35/55 (63%), Positives = 48/55 (87%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEE 155 GCSWIEIQG +NVF VKDKRH R+KEIY++L+++++QMK+AGY+PY +E DE+ Sbjct: 630 GCSWIEIQGELNVFMVKDKRHARKKEIYMVLRTILQQMKQAGYVPYVGSNEFDED 684 >ref|XP_011022929.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Populus euphratica] Length = 710 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/67 (56%), Positives = 51/67 (76%) Frame = -1 Query: 319 GCSWIEIQGHVNVFTVKDKRHPRRKEIYLLLKSLVRQMKRAGYIPYAFGHEVDEEYSDSE 140 GCSWI IQ +++VF VKDKRHP++KEIY +LK L + M++AGY+P A HE EE S+ E Sbjct: 635 GCSWIGIQSNMHVFMVKDKRHPQKKEIYSILKLLTKHMRQAGYVPDASDHEAYEEPSELE 694 Query: 139 FTSCYTM 119 +SC+ M Sbjct: 695 SSSCFHM 701