BLASTX nr result
ID: Ziziphus21_contig00034413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034413 (415 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095547.1| hypothetical protein L484_016021 [Morus nota... 73 1e-10 ref|XP_011003065.1| PREDICTED: uncharacterized protein LOC105109... 59 1e-06 ref|XP_002306949.1| hypothetical protein POPTR_0005s26440g [Popu... 59 1e-06 ref|XP_007222167.1| hypothetical protein PRUPE_ppa005807mg [Prun... 57 5e-06 >ref|XP_010095547.1| hypothetical protein L484_016021 [Morus notabilis] gi|587871404|gb|EXB60667.1| hypothetical protein L484_016021 [Morus notabilis] Length = 427 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 135 MEPVAFVTDKFKGFARWSQDLVDGLFYRRGETSSRRNPIDILKRL 1 MEPV+FV DKF+GF +WSQD DGL +RR +TS RRNPI+ILKRL Sbjct: 1 MEPVSFVADKFEGFGKWSQDFFDGLIHRRRDTSGRRNPIEILKRL 45 >ref|XP_011003065.1| PREDICTED: uncharacterized protein LOC105109896 [Populus euphratica] Length = 426 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = -2 Query: 135 MEPVAFVTDKFKGFARWSQDLVDGLFYRRGETSSRRNPIDILKRL 1 MEPVA V DK KG A+ QD VDGL RR E SSRRNPI+ILKRL Sbjct: 1 MEPVASVVDKIKGVAKSGQDFVDGLL-RRRENSSRRNPIEILKRL 44 >ref|XP_002306949.1| hypothetical protein POPTR_0005s26440g [Populus trichocarpa] gi|222856398|gb|EEE93945.1| hypothetical protein POPTR_0005s26440g [Populus trichocarpa] Length = 427 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = -2 Query: 135 MEPVAFVTDKFKGFARWSQDLVDGLFYRRGETSSRRNPIDILKRL 1 MEPVA V DK KG A+ QD VDGL RR E SSRRNPI+ILKRL Sbjct: 1 MEPVASVVDKIKGVAKSGQDFVDGLL-RRRENSSRRNPIEILKRL 44 >ref|XP_007222167.1| hypothetical protein PRUPE_ppa005807mg [Prunus persica] gi|462419103|gb|EMJ23366.1| hypothetical protein PRUPE_ppa005807mg [Prunus persica] Length = 443 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -2 Query: 135 MEPVAFVTDKFKGFARWSQDLVDGLFYRRGETSSRRNPIDILKRL 1 MEPVAFV DKF+G + +Q+L DGL + + S+RR+PI+ILKRL Sbjct: 1 MEPVAFVVDKFRGLTKSTQELFDGLIHGHPQRSARRHPIEILKRL 45