BLASTX nr result
ID: Ziziphus21_contig00034208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034208 (451 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005643265.1| hypothetical protein COCSUDRAFT_60029 [Cocco... 57 4e-06 >ref|XP_005643265.1| hypothetical protein COCSUDRAFT_60029 [Coccomyxa subellipsoidea C-169] gi|384245226|gb|EIE18721.1| hypothetical protein COCSUDRAFT_60029 [Coccomyxa subellipsoidea C-169] Length = 195 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 450 LNRNGWGPFNQRAEIWNGRLAMVAFTVLLLVETFRDGPALVP 325 LN +G GPF Q+AE+ NGR+AMVAF +L+ VET++ GP LVP Sbjct: 154 LNIDGAGPFTQKAEVVNGRIAMVAFALLIAVETWKAGPGLVP 195