BLASTX nr result
ID: Ziziphus21_contig00034132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034132 (223 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010091280.1| Pentatricopeptide repeat-containing protein ... 119 9e-25 ref|XP_010091279.1| hypothetical protein L484_002907 [Morus nota... 119 9e-25 ref|XP_009366860.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_008361359.1| PREDICTED: pentatricopeptide repeat-containi... 110 5e-22 ref|XP_007200169.1| hypothetical protein PRUPE_ppa016573mg [Prun... 108 2e-21 ref|XP_002525492.1| pentatricopeptide repeat-containing protein,... 107 3e-21 ref|XP_010062359.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 gb|KCW69486.1| hypothetical protein EUGRSUZ_F02938 [Eucalyptus g... 107 4e-21 ref|XP_007157018.1| hypothetical protein PHAVU_002G036600g [Phas... 105 2e-20 ref|XP_006441713.1| hypothetical protein CICLE_v10024266mg [Citr... 105 2e-20 ref|XP_003610897.1| pentatricopeptide (PPR) repeat protein [Medi... 105 2e-20 ref|XP_008237768.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_006478452.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_012076873.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_011458229.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 gb|KRH77729.1| hypothetical protein GLYMA_01G230500 [Glycine max] 101 2e-19 gb|KHN25594.1| Pentatricopeptide repeat-containing protein [Glyc... 101 2e-19 ref|XP_007015025.1| Tetratricopeptide repeat-like superfamily pr... 100 4e-19 gb|KOM27661.1| hypothetical protein LR48_Vigan442s009700 [Vigna ... 97 5e-18 emb|CBI17032.3| unnamed protein product [Vitis vinifera] 97 5e-18 >ref|XP_010091280.1| Pentatricopeptide repeat-containing protein [Morus notabilis] gi|587854128|gb|EXB44216.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 822 Score = 119 bits (298), Expect = 9e-25 Identities = 53/70 (75%), Positives = 63/70 (90%) Frame = +1 Query: 13 CLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSI 192 C R C QLHCLTVKTGF+S+VKVATAL++AYSDLGG+ DCY++FLET+C+ DIVSWTSI Sbjct: 292 CFRFCLQLHCLTVKTGFLSEVKVATALMKAYSDLGGNAVDCYRVFLETSCHRDIVSWTSI 351 Query: 193 ITTFAERDPE 222 +T FAERDPE Sbjct: 352 MTIFAERDPE 361 >ref|XP_010091279.1| hypothetical protein L484_002907 [Morus notabilis] gi|587854127|gb|EXB44215.1| hypothetical protein L484_002907 [Morus notabilis] Length = 741 Score = 119 bits (298), Expect = 9e-25 Identities = 53/70 (75%), Positives = 63/70 (90%) Frame = +1 Query: 13 CLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSI 192 C R C QLHCLTVKTGF+S+VKVATAL++AYSDLGG+ DCY++FLET+C+ DIVSWTSI Sbjct: 292 CFRFCLQLHCLTVKTGFLSEVKVATALMKAYSDLGGNAVDCYRVFLETSCHRDIVSWTSI 351 Query: 193 ITTFAERDPE 222 +T FAERDPE Sbjct: 352 MTIFAERDPE 361 >ref|XP_009366860.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420 [Pyrus x bretschneideri] Length = 757 Score = 112 bits (279), Expect = 1e-22 Identities = 50/72 (69%), Positives = 61/72 (84%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 N+ + C QLHCLT++TG I ++VATALV+AYSDLGG V DCY+LFLET+C+ DIV+WT Sbjct: 295 NVVSKFCFQLHCLTIRTGLILKIEVATALVKAYSDLGGDVADCYRLFLETSCHRDIVAWT 354 Query: 187 SIITTFAERDPE 222 IITTFAERDPE Sbjct: 355 GIITTFAERDPE 366 >ref|XP_008361359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420 [Malus domestica] Length = 757 Score = 110 bits (274), Expect = 5e-22 Identities = 50/72 (69%), Positives = 60/72 (83%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 N+ + C QLHCLT++TG I ++VATALV+AYSDLGG V DCY+LFLET+C DIV+WT Sbjct: 295 NVVSKFCFQLHCLTIRTGLILKIEVATALVKAYSDLGGDVADCYRLFLETSCDRDIVAWT 354 Query: 187 SIITTFAERDPE 222 IITTFAERDPE Sbjct: 355 GIITTFAERDPE 366 >ref|XP_007200169.1| hypothetical protein PRUPE_ppa016573mg [Prunus persica] gi|462395569|gb|EMJ01368.1| hypothetical protein PRUPE_ppa016573mg [Prunus persica] Length = 755 Score = 108 bits (269), Expect = 2e-21 Identities = 47/68 (69%), Positives = 58/68 (85%) Frame = +1 Query: 19 RLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSIIT 198 + C QLHCLT+KTGF ++VATALV+AYSDLGG + DCY+LF ET+C+ DIV+WT IIT Sbjct: 297 KFCFQLHCLTIKTGFTLKIEVATALVKAYSDLGGDIADCYRLFSETSCHRDIVAWTGIIT 356 Query: 199 TFAERDPE 222 TF+ERDPE Sbjct: 357 TFSERDPE 364 >ref|XP_002525492.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535171|gb|EEF36850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 542 Score = 107 bits (267), Expect = 3e-21 Identities = 49/73 (67%), Positives = 58/73 (79%) Frame = +1 Query: 4 SNLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSW 183 S++ L C QLHCL++++ F+ V+VATALV+AYSDLGG V DCYKLFLET CY DIVSW Sbjct: 282 SDVGLNYCFQLHCLSIRSAFVLQVEVATALVKAYSDLGGEVTDCYKLFLETGCYKDIVSW 341 Query: 184 TSIITTFAERDPE 222 T IIT AER PE Sbjct: 342 TGIITALAERQPE 354 >ref|XP_010062359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420 [Eucalyptus grandis] Length = 742 Score = 107 bits (266), Expect = 4e-21 Identities = 49/74 (66%), Positives = 56/74 (75%) Frame = +1 Query: 1 GSNLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVS 180 G L C QLHCLTVKTGF S+V+V TALV+AYSDLGG DCYKLFLETN + D++ Sbjct: 281 GVGFALNCCLQLHCLTVKTGFTSEVEVTTALVKAYSDLGGDAADCYKLFLETNSHKDVIC 340 Query: 181 WTSIITTFAERDPE 222 WT IIT AER+PE Sbjct: 341 WTGIITALAEREPE 354 >gb|KCW69486.1| hypothetical protein EUGRSUZ_F02938 [Eucalyptus grandis] Length = 644 Score = 107 bits (266), Expect = 4e-21 Identities = 49/74 (66%), Positives = 56/74 (75%) Frame = +1 Query: 1 GSNLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVS 180 G L C QLHCLTVKTGF S+V+V TALV+AYSDLGG DCYKLFLETN + D++ Sbjct: 183 GVGFALNCCLQLHCLTVKTGFTSEVEVTTALVKAYSDLGGDAADCYKLFLETNSHKDVIC 242 Query: 181 WTSIITTFAERDPE 222 WT IIT AER+PE Sbjct: 243 WTGIITALAEREPE 256 >ref|XP_007157018.1| hypothetical protein PHAVU_002G036600g [Phaseolus vulgaris] gi|561030433|gb|ESW29012.1| hypothetical protein PHAVU_002G036600g [Phaseolus vulgaris] Length = 767 Score = 105 bits (261), Expect = 2e-20 Identities = 44/72 (61%), Positives = 63/72 (87%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 N+ LR C QLHCLTVK+GFI++++V TAL+++Y++LGGH+ DCY++FL+T+ DIVSWT Sbjct: 305 NVHLRKCFQLHCLTVKSGFITEIEVITALIKSYANLGGHISDCYRIFLDTSSELDIVSWT 364 Query: 187 SIITTFAERDPE 222 ++I+ FAERDPE Sbjct: 365 ALISVFAERDPE 376 >ref|XP_006441713.1| hypothetical protein CICLE_v10024266mg [Citrus clementina] gi|557543975|gb|ESR54953.1| hypothetical protein CICLE_v10024266mg [Citrus clementina] Length = 717 Score = 105 bits (261), Expect = 2e-20 Identities = 50/72 (69%), Positives = 58/72 (80%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 +L LR C QLHCL+VKTGFIS VKV +ALV+AYSDLGG +DDCYKLFLET D+V WT Sbjct: 282 DLGLRFCFQLHCLSVKTGFISGVKVISALVKAYSDLGGDIDDCYKLFLETGNSRDVVLWT 341 Query: 187 SIITTFAERDPE 222 +IT FAE +PE Sbjct: 342 GMITAFAECEPE 353 >ref|XP_003610897.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355512232|gb|AES93855.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 774 Score = 105 bits (261), Expect = 2e-20 Identities = 47/69 (68%), Positives = 60/69 (86%) Frame = +1 Query: 16 LRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSII 195 L+ C QLHCLTVK+G IS+V+V TALV++Y+DLGGH+ DC+KLFL+T+ DIVSWT+II Sbjct: 315 LKNCFQLHCLTVKSGLISEVEVVTALVKSYADLGGHISDCFKLFLDTSGEHDIVSWTAII 374 Query: 196 TTFAERDPE 222 + FAERDPE Sbjct: 375 SVFAERDPE 383 >ref|XP_008237768.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420 [Prunus mume] Length = 755 Score = 104 bits (260), Expect = 2e-20 Identities = 45/68 (66%), Positives = 57/68 (83%) Frame = +1 Query: 19 RLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSIIT 198 + C QLHCLT+K GF ++VATALV+AYSDLGG + DCY+LF ET+C+ DIV+WT IIT Sbjct: 297 KFCFQLHCLTIKAGFTLKIEVATALVKAYSDLGGDIADCYRLFSETSCHRDIVAWTGIIT 356 Query: 199 TFAERDPE 222 TF+E+DPE Sbjct: 357 TFSEQDPE 364 >ref|XP_006478452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Citrus sinensis] Length = 744 Score = 104 bits (260), Expect = 2e-20 Identities = 49/72 (68%), Positives = 58/72 (80%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 +L LR C QLHCL+VKTGFIS +KV +ALV+AYSDLGG +DDCYKLFLET D+V WT Sbjct: 282 DLGLRFCFQLHCLSVKTGFISGIKVISALVKAYSDLGGDIDDCYKLFLETGNSRDVVLWT 341 Query: 187 SIITTFAERDPE 222 +IT FAE +PE Sbjct: 342 GMITAFAECEPE 353 >ref|XP_012076873.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420 [Jatropha curcas] Length = 750 Score = 102 bits (253), Expect = 1e-19 Identities = 46/69 (66%), Positives = 58/69 (84%) Frame = +1 Query: 16 LRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSII 195 L++C QLH +++K+GF+ ++VATALV+AYSDLG V DCYKLF ET+C DIVSWT II Sbjct: 291 LKICLQLHGVSIKSGFVLQIEVATALVKAYSDLGREVTDCYKLFSETDCCRDIVSWTGII 350 Query: 196 TTFAERDPE 222 TTFAER+PE Sbjct: 351 TTFAEREPE 359 >ref|XP_011458229.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Fragaria vesca subsp. vesca] gi|764529807|ref|XP_011458230.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Fragaria vesca subsp. vesca] Length = 792 Score = 102 bits (253), Expect = 1e-19 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = +1 Query: 19 RLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSIIT 198 + C QLHCL VKTGFI ++V TA+V+AYSDLGG V DCY+LF ET+C+ DIV+WT I+T Sbjct: 334 KFCYQLHCLVVKTGFILGIEVVTAIVKAYSDLGGDVADCYRLFSETSCHRDIVAWTGIMT 393 Query: 199 TFAERDPE 222 F++RDPE Sbjct: 394 IFSQRDPE 401 >gb|KRH77729.1| hypothetical protein GLYMA_01G230500 [Glycine max] Length = 757 Score = 101 bits (251), Expect = 2e-19 Identities = 42/72 (58%), Positives = 60/72 (83%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 N LR C QLHCLT+K+G IS+++V TAL+++Y++LGGH+ DCY++F +T+ DIVSWT Sbjct: 295 NTYLRKCFQLHCLTIKSGLISEIEVVTALIKSYANLGGHISDCYRIFHDTSSQLDIVSWT 354 Query: 187 SIITTFAERDPE 222 ++I+ FAERDPE Sbjct: 355 ALISVFAERDPE 366 >gb|KHN25594.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 1274 Score = 101 bits (251), Expect = 2e-19 Identities = 42/72 (58%), Positives = 60/72 (83%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 N LR C QLHCLT+K+G IS+++V TAL+++Y++LGGH+ DCY++F +T+ DIVSWT Sbjct: 812 NTYLRKCFQLHCLTIKSGLISEIEVVTALIKSYANLGGHISDCYRIFHDTSSQLDIVSWT 871 Query: 187 SIITTFAERDPE 222 ++I+ FAERDPE Sbjct: 872 ALISVFAERDPE 883 >ref|XP_007015025.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508785388|gb|EOY32644.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 741 Score = 100 bits (249), Expect = 4e-19 Identities = 48/71 (67%), Positives = 58/71 (81%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 +L L+ C QL CL+VKTGFIS+V+VATA ++AYSDLGG V + Y+LFLET C DIV WT Sbjct: 279 DLGLKFCFQLFCLSVKTGFISEVEVATAFMKAYSDLGGDVSEFYQLFLETTCGQDIVFWT 338 Query: 187 SIITTFAERDP 219 S+ITTFAE DP Sbjct: 339 SMITTFAEHDP 349 >gb|KOM27661.1| hypothetical protein LR48_Vigan442s009700 [Vigna angularis] Length = 767 Score = 97.1 bits (240), Expect = 5e-18 Identities = 42/72 (58%), Positives = 60/72 (83%) Frame = +1 Query: 7 NLCLRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWT 186 N+ LR C QLHCLTVK+G I++V+V TAL+++Y++LGG + DCY++F +T+ DIVSWT Sbjct: 305 NVNLRKCFQLHCLTVKSGLITEVEVITALIKSYANLGGPISDCYRIFHDTSSQLDIVSWT 364 Query: 187 SIITTFAERDPE 222 ++I+ FAERDPE Sbjct: 365 ALISVFAERDPE 376 >emb|CBI17032.3| unnamed protein product [Vitis vinifera] Length = 694 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/69 (63%), Positives = 53/69 (76%) Frame = +1 Query: 16 LRLCSQLHCLTVKTGFISDVKVATALVRAYSDLGGHVDDCYKLFLETNCYGDIVSWTSII 195 L C QL CLT KTGFIS+++V T LV+AYS LGG V+DCY++FLE + D+VSWT II Sbjct: 272 LECCFQLQCLTTKTGFISEIEVPTGLVKAYSSLGGEVNDCYRIFLELDGRQDVVSWTGII 331 Query: 196 TTFAERDPE 222 FAERDPE Sbjct: 332 AVFAERDPE 340