BLASTX nr result
ID: Ziziphus21_contig00034061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034061 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)aspar... 61 3e-07 >ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] gi|223536193|gb|EEF37846.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] Length = 624 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 3 YDEVGYACQEKKQSHLGSGLNKWWPFPARKALLTSDLLVNNKGV 134 YD+VG C +K+QSHLG GL++WWP P R+A L S+LL NN GV Sbjct: 582 YDKVGNKCNKKEQSHLGFGLSRWWPLPTRRASLASELL-NNHGV 624