BLASTX nr result
ID: Ziziphus21_contig00034014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034014 (432 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102916.1| Putative disease resistance protein RGA4 [Mo... 59 1e-06 >ref|XP_010102916.1| Putative disease resistance protein RGA4 [Morus notabilis] gi|587906362|gb|EXB94434.1| Putative disease resistance protein RGA4 [Morus notabilis] Length = 1131 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/93 (37%), Positives = 46/93 (49%), Gaps = 1/93 (1%) Frame = +3 Query: 36 DDFFTPSKAASLMPSLEILFLEGLSNLKGWWRDTVTDGXXXXXXXXXXXXFLYFPRLSDS 215 D FF+ S S++PSLE L LE L +GWWR + F FPRLS Sbjct: 829 DSFFSTSSPVSVLPSLETLKLEVLPKFRGWWRSDMA-----AENQVEQVVFPSFPRLSHL 883 Query: 216 HIQGCPKLKFLPFSPSI-AHLTLESSTWMPFHR 311 I GCPKL +P P++ LTL ++ F + Sbjct: 884 SIYGCPKLTSMPCYPNVEGELTLSDTSGKHFEQ 916