BLASTX nr result
ID: Ziziphus21_contig00033890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033890 (1388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535405.1| conserved hypothetical protein [Ricinus comm... 88 2e-17 >ref|XP_002535405.1| conserved hypothetical protein [Ricinus communis] gi|223523223|gb|EEF26979.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 87.8 bits (216), Expect(2) = 2e-17 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +2 Query: 344 EGSQKSIDKTPSRPTGLYVWVLFHLKLGLGRVPLNYRSIRIIINTRKEMDSPA 502 +G +KSI+K PSRPTGLYVWVLFHLKLGLGRVP YRSI II NTRKEMDSPA Sbjct: 15 KGGKKSIEKIPSRPTGLYVWVLFHLKLGLGRVPFFYRSI-IINNTRKEMDSPA 66 Score = 30.8 bits (68), Expect(2) = 2e-17 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 271 MHYSIWKGLSLVGKE 315 MHYSIWKGLSL G++ Sbjct: 1 MHYSIWKGLSLEGQK 15