BLASTX nr result
ID: Ziziphus21_contig00033546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00033546 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008357451.1| PREDICTED: putative disease resistance prote... 56 9e-06 ref|XP_008378192.1| PREDICTED: disease resistance protein RGA2-l... 56 9e-06 >ref|XP_008357451.1| PREDICTED: putative disease resistance protein At3g14460 [Malus domestica] Length = 474 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = -2 Query: 258 NCGNLKSLPPFLKLTPLHTLCINTCGVLSQSLQNSE-EEFTKIFHIPRIIIDGQEL 94 NC LK+LP FL+ TPL TL I CG L++ Q +E+ KI HIP I IDG+ + Sbjct: 376 NCSQLKTLPDFLRKTPLQTLVIRRCGNLARGCQKGRGKEWPKISHIPNIRIDGKRI 431 >ref|XP_008378192.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica] Length = 523 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = -2 Query: 258 NCGNLKSLPPFLKLTPLHTLCINTCGVLSQSLQNSE-EEFTKIFHIPRIIIDGQEL 94 NC LK+LP FL+ TPL TL I CG L++ Q +E+ KI HIP I IDG+ + Sbjct: 425 NCSQLKTLPDFLRKTPLQTLVIRRCGNLARGCQKGRGKEWPKISHIPNIRIDGKRI 480